KEGG   Mycobacterium sp. VKM Ac-1817D: G155_08015Help
Entry
G155_08015        CDS       T03634                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00473  D-Alanine metabolism
myv01100  Metabolic pathways
myv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:myv00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    G155_08015
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    G155_08015
Enzymes [BR:myv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     G155_08015
Peptidoglycan biosynthesis and degradation proteins [BR:myv01011]
 Precursor biosynthesis
  Racemase
   G155_08015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIY45528
UniProt: A0A0A1FLD2
LinkDB All DBs
Position
1690976..1692145
Genome map
AA seq 389 aa AA seqDB search
MQTTERETSLIPHASPQAVVDLGAIDHNVRLLRQHAGDARVMAVVKADAYGHGAVEVGKA
ALAAGAAELGVVTVAEAVALRAGGITAPVLCWLHPPGTDFTPALENDVQIAVSSARQLDD
VLTAVRRTGRSATITVKVDTGLSRNGVSPADFPAMVTTLGRAQADGEIRVRGIMSHLVHG
DDPDNPFNELQGKRLTAMREQAAEQGVVFEVAHIANSPAAMTRPDLAFDMVRPGIAVYGL
SPIPERGDMGLIPAMTLKCPVALVRSIRAGDGVSYGHRWIADRDTMLALLPVGYADGIFR
SLSGRIEVLIKGRRRQAVGRICMDQFVVDLGPDAADVAEGDEAILFGPGTSGEQTAQDWA
ELLGTINYEVVTSPRGRITRSYVQAGRER
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgaccgaacgcgagacatcgctgatcccgcacgcatcgccgcaggcggtggtg
gatctcggcgccatcgaccacaacgtccgcctgctgcgtcaacatgccggtgacgcgcgg
gtgatggccgtggtcaaggccgacgcgtacggacacggcgccgtcgaggtgggcaaggcc
gcactggccgccggtgccgccgagctcggggtggtgacggtcgccgaggcagtcgcactg
cgagccggaggcatcaccgccccggtgctgtgctggctgcatccgccgggcaccgatttc
acgccggcgctggaaaacgatgtacagatcgcggtgtcctcggcgcgccagctcgacgac
gtgctgacggctgtacgccggacgggtcggagcgcgaccatcacggtgaaggtcgacacc
ggcctgagccgcaacggcgtgagtccggccgactttcccgcgatggtcaccacgctcggc
cgcgcccaagccgacggggagatccgggtgcgcggcatcatgagtcacctggtgcacggc
gacgatcccgacaacccgttcaacgagctgcagggcaaacgcctgaccgcgatgcgcgag
caggccgccgagcagggtgtggtgttcgaggtggcgcacatcgccaactcgcccgctgcg
atgacgcgtccggatctggctttcgacatggtccggcccggtatcgcggtctacgggctc
agccccatccccgagcgcggcgacatgggactgatccccgccatgacattgaaatgccct
gtcgcactggtccgttcgattcgcgccggtgacggagtgtcctatggtcaccggtggatc
gcggaccgcgacaccatgctggcgttgctgccggtgggctacgcagacggcatcttccgc
tcgttgagcgggcggatcgaggtgctgatcaagggcagacgtcgacaggccgtcgggcgg
atctgcatggatcagttcgtcgtcgatctcggtccggatgccgccgacgtggccgaaggt
gacgaagcgatcctgttcgggcccggcacatccggtgaacagaccgcccaggactgggcc
gaactgctcggcaccatcaactacgaagtggtcaccagcccgcggggacggatcacccgc
agctacgtgcaggcaggtcgcgagcgttga

DBGET integrated database retrieval system