KEGG   Mycobacterium sp. VKM Ac-1817D: G155_08910Help
Entry
G155_08910        CDS       T03634                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00564  Glycerophospholipid metabolism
myv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:myv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    G155_08910
Enzymes [BR:myv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     G155_08910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA 3HCDH_N AlaDh_PNT_C NAD_binding_8 HI0933_like Thi4 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AIY45662
UniProt: A0A0A1FRP5
LinkDB All DBs
Position
1872640..1874385
Genome map
AA seq 581 aa AA seqDB search
MTDPISAPGDGQTFLGPQHRAQAWQRLGSEQFDVVVIGGGVVGAGAALDAATRGLTVALV
EARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALHERELSLTTLAPHLVKPLPFLFPL
TNRWWERPYIAAGIFLYDQLGGAKSVPAQKHLTKAGALRLAPGLKRSSLIGGIRYYDTVV
DDARHTMTVARTAAHYGAVVRSSSQVVALLREGDRVVGVTLRDSEDGATTDVRGHVVVNA
TGVWTDEIQALSKERGRFRVRASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGTHWI
IGTTDTDWNLDLAHPAATKADIDYILGHVNTVLATPLTHDDIDGVYAGLRPLLAGESEET
SKLSREHAVAVPSPGLVAIAGGKYTTYRVMAADAIDAAAQFIPARVAPSITEKVPLMGAD
GYFALINQTEYVGKQYGLHPYRVRHLLDRYGSLIGEVLKMAEGRPELLAPITDAPVYLKV
EAYYAAAAEGALHLEDILARRMRIAIEYPHRGVDCAREVAEVVAPVLGWTAEDVDREVAT
YIARVEAEVLSQTQPDDESADALRQAAPEARAEILEPVPLT
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacccgatctcagcaccgggcgacgggcaaaccttcctcggtccgcagcacagg
gcgcaagcctggcaacgactcggcagcgaacaattcgacgtggtggtgatcggcggcggt
gtcgtcggcgccggtgctgcgttggacgcggcgacccgtggactcaccgtggccctcgtc
gaggcccgcgatttcgcttccggcacatccagccgcagctccaagatgttccacggaggt
ctgcgctacctcgaacagttggagttcggcctggtccgcgaagccctccacgagcgggaa
ctgagcctgaccaccctcgcgccgcatctggtcaagccgttgccgttcctgttcccgttg
accaaccgttggtgggagcggccttacattgcggccgggatcttcctgtacgaccagctc
ggcggagcgaaatcggttcccgcacagaagcatctgaccaaagccggcgcacttcggctg
gctcctgggctcaagcgcagctcgctgatcggtggtatccgctactacgacaccgtggtc
gacgatgcccgtcacacgatgacggtggcgcgcaccgcggcccactacggcgcggtggtg
cgctcgtccagtcaggtggtggcgttgttgcgtgagggtgatcgcgtggtcggagtgacc
ctgcgtgattccgaggacggagccaccaccgacgtgcggggccatgtcgtggtcaacgcg
accggagtatggaccgacgagattcaggcactgtccaaagagcgcggccgcttccgggtg
cgcgcctccaagggcgtgcacatcgtggtgccgcgcgatcggatcgtcagcgaggtcgcg
atcatcctgcgcaccgagaagtcggtgctgttcgtgattccgtggggtacgcactggatc
atcggcaccaccgacacggactggaatctcgacctcgcccaccccgccgcgaccaaggcc
gacatcgattacatcctcggccatgtcaacaccgtgctggcgaccccgttgacccatgac
gacatcgatggtgtctacgcaggattgcgtccgctactggccggcgagagcgaggagact
tccaagctctcacgtgagcacgctgtggcggtgccttctcctggcttggtggccatcgcc
ggcgggaagtacaccacctaccgcgtgatggcggccgacgcgattgacgctgcggcacag
ttcatcccggcgcgggtggcaccctcgatcaccgagaaggtcccgctcatgggtgccgac
ggatacttcgccctgatcaatcagaccgaatacgtcggcaagcaatacgggctgcacccg
taccgtgtccggcacctgctggaccgttacggctcgctgatcggtgaagtgctcaagatg
gccgaggggcggcccgagctgctggccccgatcaccgatgcgccggtatatctcaaggtc
gaggcctactacgccgcagcggccgaaggggctctgcacctggaggacatcctggcgcgc
cggatgcggattgccatcgaatacccgcaccgcggcgtcgattgcgcccgtgaggtggcc
gaagtcgttgcgccggtgctgggctggacggccgaggacgtcgaccgtgaggttgccacc
tatatcgccagggtggaggcggaggtgctgtcgcagacccagcccgacgacgagtccgcc
gatgcactgcgccaggccgcgcccgaggcgcgcgccgagatcctcgaacccgtgccgctg
acttga

DBGET integrated database retrieval system