KEGG   Mycobacterium sp. VKM Ac-1817D: G155_13470Help
Entry
G155_13470        CDS       T03634                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00280  Valine, leucine and isoleucine degradation
myv00410  beta-Alanine metabolism
myv00640  Propanoate metabolism
myv00650  Butanoate metabolism
myv01100  Metabolic pathways
myv01120  Microbial metabolism in diverse environments
Module
myv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:myv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    G155_13470
   00650 Butanoate metabolism
    G155_13470
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    G155_13470
   00280 Valine, leucine and isoleucine degradation
    G155_13470
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    G155_13470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:myv01007]
    G155_13470
Enzymes [BR:myv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     G155_13470
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     G155_13470
Amino acid related enzymes [BR:myv01007]
 Aminotransferase (transaminase)
  Class III
   G155_13470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIY49428
UniProt: A0A0A1FXK1
LinkDB All DBs
Position
complement(2780256..2781596)
Genome map
AA seq 446 aa AA seqDB search
MSHPEQSRHLATTIPGPKSQALIARKSAAVARGVGNTMPVYAVRAGGGIVEDVDGNRLID
LGSGIAVTTIGNSSPRVVEAVATQAAEFTHTCFMVTPYEQYVAVCEHLNRLTPVRGDKRS
ALFNSGSEAVENAVKIARSHTHKPAVVAFDHAYHGRTNLTMALTAKAMPYKHGFGPFAPE
IYRAPLSYPYRDAEFGKELATDGALAARRAIDVMEKQIGADNLAAVIIEPIQGEGGFIVP
ADGFLPALLGWCRDNDVVFIADEVQTGFARTGAMFACEHEGIDPDLIVTAKGIADGLPLS
AVTGRAEIMDSPHVSGLGGTYGGNPIACAAALATIETIEADGLIARAQHIEQLMKDRLGR
LQAEDERIGDVRGRGAMIAVELVKAGTTTPDPELTKALCAGAHTAGVIVLSCGTYGNVLR
FLPPLTISDELLIEGLDVLELILRDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ttgagccatcccgagcagagccgccacctggccaccacgattcccgggccgaaatcgcaa
gcgttgatcgcccggaaatcggcggcagtcgcccgcggcgtcggcaacaccatgcccgtg
tacgcggtccgcgccgggggcggcatcgtcgaagacgttgacggcaatcggctcatcgat
ctggggtcgggcatcgcggtgaccaccatcggcaactcgtctccgcgcgtcgtcgaagcg
gtagcgacgcaggccgccgagttcacccatacgtgcttcatggtgacgccgtacgagcag
tacgtcgcggtgtgcgaacacctcaaccggctgacaccggtccgcggggacaagcgttcg
gccttgttcaactccgggtcggaggccgtggagaacgcggtcaagatcgcgcggtcccac
acccacaagcccgccgtcgtcgccttcgaccacgcctatcacgggcgcaccaacctcacg
atggcgctgaccgccaaggccatgccctacaagcacggcttcggcccgttcgctccggag
atctaccgagcgccgctgtcctacccgtaccgcgacgccgagttcggcaaggaactggcc
accgacggcgcactcgcggccaggcgcgccatcgatgtgatggaaaagcagatcggcgcc
gacaacttggccgcggtcatcatcgagcccatccagggcgagggcgggttcatcgtcccg
gccgacgggttcctgcctgcgctgctgggttggtgccgcgacaacgacgtggtgttcatc
gccgacgaggtgcagaccgggttcgcccggaccggcgcgatgttcgcatgcgagcacgag
ggcatcgaccccgatctgatcgtcaccgccaagggcatcgccgatggcctcccgctgtcc
gcggtcaccgggcgggccgagatcatggactcgccgcacgtctccggactgggcggcacc
tatggcggcaatccgatcgcgtgcgcggcggcactggccacgatcgagaccatcgaggcc
gacggattgatcgcccgcgcccagcacatcgagcagctgatgaaagatcggctgggccgg
ttgcaggccgaggacgagcggatcggtgatgtacgcggccggggcgcgatgatcgccgtc
gaactggtcaaggccggcacgaccacacccgaccctgagctgaccaaggcgctctgcgcc
ggtgcccatacggccggggtgatcgtgctgtcctgcggtacctacggcaacgtgctgcgc
ttcctgccgccgctgaccatcagcgacgagctgctgatcgaggggctcgacgtgctcgag
ctgatcctgcgcgacctctga

DBGET integrated database retrieval system