KEGG   Mycobacterium sp. VKM Ac-1817D: G155_26920Help
Entry
G155_26920        CDS       T03634                                 

Definition
(GenBank) cell division protein FtsH
  KO
K03798  cell division protease FtsH [EC:3.4.24.-]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Brite
KEGG Orthology (KO) [BR:myv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:myv01002]
    G155_26920
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:myv03110]
    G155_26920
Enzymes [BR:myv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     G155_26920
Peptidases and inhibitors [BR:myv01002]
 Metallo peptidases
  Family M41: FtsH endopeptidase family
   G155_26920
Chaperones and folding catalysts [BR:myv03110]
 Other chaperones and cochaperones
  AAA proteases
   G155_26920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M41 AAA AAA_lid_3 FtsH_ext AAA_5 RuvB_N AAA_16 TIP49 AAA_22 AAA_33 Mg_chelatase IstB_IS21 TsaE AAA_24 UPF0020 AAA_28 AAA_17 AAA_25 AAA_2 AAA_18 RseC_MucC
Motif
Other DBs
NCBI-ProteinID: AIY48557
UniProt: A0A0A1G093
LinkDB All DBs
Position
complement(5624998..5627331)
Genome map
AA seq 777 aa AA seqDB search
MNRKNVIRTLTVIAVVLLLGWSFFYFSDDTRGYKPVDTSVAVAQIGADNVKNAQIDDREQ
QLRLDLKSGKEETENSDKVITKYPTGYAVKLVDQLDAKHVKFGTTVNQGSFLGSMLIYML
PLLLLVALFVMFSRMQGGGRMGFGFGKSKAKQLGKDMPKTTFADVAGVDEAVEELYEIKD
FLQNPSRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVG
ASRVRDMFEQAKANSPCIIFVDEIDAVGRQRGAGMGGGHDEREQTLNQLLVEMDGFGDRQ
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRAVLKVHSAGKPIAPDADLDGL
AKRTVGMSGADLANVINEAALLTARENGTLITGAALEEAVDRVVGGPRRKGRIISEQEKK
ITAYHEGGHTLAAWAMPDIEPIYKVTILARGRTGGHAVAVPEDDKGLMTRSEMIARLVFA
MGGRAAEELVFREPTTGAVSDIEQATKIARAMVTEYGMSSKLGAVRYGSEHGDPFLGRTM
GTQADFGHEVARDIDDEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRAELEA
IFGDVKKRPRLTMFDDFGGRVPSDKPPIKTPGEIAIERGEPWPPPVPEPAFKAAIAAATR
EAERAKETNGSGANGAPPNGSNQNGSTQPDYGAPAGWHAPGWPPAPSQPGYQPPQPQQQP
QGYWYPPPHPSGWQQPQPYPYQPYPHPGQPAPNEEAGQDRAPERTDRSDRSNPPAHG
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcaaaaatgtgatccgtacgctgaccgtgatcgcggtcgtgctgttgctgggc
tggtcgtttttctatttcagcgacgacacccgcggctacaagcccgtcgacacctcggtg
gcggtggcccagatcggtgccgacaacgtcaagaacgcccagatcgacgaccgtgagcag
cagctgcgtctcgacctgaagagcggcaaagaagagaccgagaacagcgacaaggtcatc
acgaagtacccgaccggctatgcggtgaagctcgtcgaccagctcgatgccaagcacgtc
aagttcggtaccaccgtcaaccagggcagcttcctcggttcgatgctgatctacatgctg
ccgttgctgttgctggtggcgctgttcgtgatgttctcccgcatgcagggcggcggccgg
atgggcttcggcttcggcaaatcgaaggccaagcagctgggcaaggacatgcccaagacc
acgttcgccgatgtggccggcgtcgacgaggccgtcgaagagctgtacgagatcaaggac
ttcctgcagaacccgtcgcgctaccaggcgctgggcgccaagattcccaagggcgtgctg
ctctacggcccgcccggaaccggcaagaccctgctggcccgcgccgtcgccggtgaggcc
ggcgttccgttcttcaccatctccggttcggacttcgtcgagatgttcgtcggtgtcggc
gcctcgcgtgtgcgcgacatgttcgaacaggccaaggccaacagtccgtgcatcatcttc
gtcgacgagatcgacgccgtcggccgccagcgtggcgccggcatgggcggcggccacgac
gagcgcgagcagacgctgaaccagttgctggtcgagatggacggcttcggcgaccgccag
ggtgtcatcctgatcgcggccaccaaccggcccgacatcctcgacccggccctgctgcgg
cccggccgcttcgaccgccagatcccggtgtccaacccggatctggccgggcgccgcgcg
gtgctcaaggtgcactcggccggcaagccgatcgcccccgacgccgacctggacgggctg
gccaagcggaccgtcggcatgtccggcgccgacctggccaacgtcatcaacgaggccgcg
ctgctcaccgcccgggagaacggcaccctcatcaccggtgctgcgctggaagaagccgtg
gaccgcgtggtcggcggcccgcgccgcaagggccgcatcatcagcgagcaggaaaaaaag
atcaccgcctaccacgagggcggacacaccctggccgcgtgggcgatgcccgacatcgag
ccgatctacaaggtgaccatcctggcccgcggacgcaccggcgggcatgccgtcgcggta
cccgaggacgacaagggtctgatgacccgctccgagatgatcgcccggctggtgttcgcc
atgggcggccgcgccgccgaggaactggtcttccgcgagcccaccacgggcgcggtgtcc
gatatcgaacaggccaccaagatcgcccgcgccatggtcaccgagtacggcatgagctcc
aagctgggtgccgtccgctacggcagcgagcacggggatccgttcctcggccgcaccatg
ggcacccaggccgacttcggccacgaggtggcccgcgacatcgatgacgaggttcgcaag
ctcatcgaggccgcccacaccgaggcgtgggagatcctcaccgaataccgcgacgtgctc
gacacgttggccggcgagctcctggagaaggagacgctgcaccgcgccgagctggaggcc
atcttcggcgacgtgaagaagcgtccccggctgaccatgttcgacgacttcggtggccgg
gtcccctcggacaaaccgccgatcaagaccccgggcgagatcgcgatcgagcgcggcgag
ccgtggccgccgccggtgcccgagccggcgttcaaggccgccatcgccgccgccacccgc
gaagccgagcgcgccaaggagaccaacggttccggcgccaacggtgcaccgccgaacggg
tcgaaccagaacggttccacccagcccgattacggcgcccctgccggctggcacgccccg
ggttggccgcccgcgccgtcgcagcccggataccagccgccgcagccgcaacagcagccg
cagggttactggtacccgccgccgcatccgtcgggatggcagcagccccagccgtacccg
tatcagccgtatcctcatcccggccagcccgcacccaacgaggaagcgggtcaggaccgt
gcccctgagcggaccgaccgttcggaccggtccaacccaccggcccacggctga

DBGET integrated database retrieval system