KEGG   Mycobacterium sp. VKM Ac-1817D: G155_27900Help
Entry
G155_27900        CDS       T03634                                 

Definition
(GenBank) protein glxC
  KO
K22082  methylamine---glutamate N-methyltransferase subunit B [EC:2.1.1.21]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00680  Methane metabolism
myv01100  Metabolic pathways
myv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:myv00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    G155_27900
Enzymes [BR:myv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.21  methylamine---glutamate N-methyltransferase
     G155_27900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GXGXG Nitro_FeMo-Co
Motif
Other DBs
NCBI-ProteinID: AIY48707
UniProt: A0A0A1G0S8
LinkDB All DBs
Position
5839811..5840506
Genome map
AA seq 231 aa AA seqDB search
MDQIAATLVGYDLRTTPLRDVNAALHQPGVEGEYVIAHPDGAHNVAVGLNAPIRVTVEGH
VGYYAAGMNQLAEVTVNGNAGTGVAENMMSGTVRVTGNASQSAGATAHGGLLIIEGDAAA
RCGISMKGVDIVVGGNIGHMSAFMAQAGRLVVRGDAGEALGDSIYEARIYVRGEVASLGA
DCVAKPMRPEHHAELAKLLSSAGFDDDTAGYTRYGSARNLYHFHVDNASEY
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaccagatagcagccacgctagtcggatatgacctgcgcacaacgcctttgcgcgat
gtcaacgccgcactgcatcagccgggcgtcgagggcgagtacgtcatcgcccaccccgac
ggcgcccacaatgtggccgtcggcctcaacgcccccatacgcgtgacggtcgaaggccac
gtcggctactacgccgccgggatgaaccagctcgccgaggtcaccgtcaacggcaacgcc
gggaccggggtggccgagaacatgatgagcggcacggtgcgcgtcaccggcaatgcctca
cagtcggcgggggccaccgcgcacggcgggctactgatcatcgagggcgacgccgctgcg
cgctgcggtatttcgatgaagggcgtggacatcgtggtgggcggcaacatcggccacatg
agcgccttcatggcccaggccggccggctggtggtgcgcggcgacgccggggaagcgctc
ggcgactcgatctatgaagcccgcatctacgtgcgcggcgaggtggcctcgctgggagcc
gactgcgtcgccaaaccgatgcggcccgagcaccacgccgagctcgcgaagttgttgtcg
tccgcgggcttcgacgatgacaccgcgggttacacccgctacggctcggcccgaaacctc
taccacttccacgtcgacaatgcgagcgagtactga

DBGET integrated database retrieval system