KEGG   Mycobacterium sp. VKM Ac-1817D: G155_28130Help
Entry
G155_28130        CDS       T03634                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
myv  Mycobacterium sp. VKM Ac-1817D
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AIY48747
UniProt: A0A0A1G0Z0
LinkDB All DBs
Position
5889471..5890544
Genome map
AA seq 357 aa AA seqDB search
MLLPVMPPVSPMLAKPVTVIPPGASYEPKWDGFRALVFRDGDDVEFGSRNERPMTRYFPE
LVRAAKAELPPRCVVDGEIVLPTEKGLDFEALQLRLHPAASRVRLLAEHTPARFIAFDLL
ALGDDNLMDRPFSERRAALAGALGSGPSFHVTPATTDIATARRWFDEFEGAGLDGLIAKG
LTLTYQPDKRVMFKIKHQRTADCVVAGYRLHKSGPDAVGSLLLGLYTDDGELASVGVIGA
FSMERRRQLFAELQPLITSFENHPWNWAEQVAADPDLARRYGGGSRWNAGKDLSFVPLRP
ERVVEVRYDHMEGRRFRHTAQFNRWRPDRDPRSCTYAQLEQPVTFGLNDIVPGLLPD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgctgctacccgtgatgccgcccgtctcgccgatgctggccaagccggtgacggtgatc
ccaccgggcgcctcctacgaaccgaagtgggacggcttccgggcgttggtgttccgcgac
ggcgacgacgttgagttcggcagccgcaacgaacgaccgatgacgcgctacttccccgaa
ctggtccgggccgcgaaagcagagctcccaccgcgatgcgtcgtcgacggcgagatcgtg
ctgccgaccgagaagggcctggatttcgaggcgttgcaactacgtctgcacccggcagct
tcccgggtgcgtctgctggccgaacacacccccgcccgcttcatcgccttcgacctgctg
gccctcggagatgacaacctcatggaccgtccgttcagcgaacgccgcgccgccctggcg
ggggcgctgggctcgggcccgtcgttccatgtcacccctgccaccacggatatcgcgacc
gcacggcgctggttcgacgagttcgagggagccgggctcgacgggctgatcgccaaaggg
ctcacgctcacctaccagcccgacaaacgggtcatgttcaagatcaaacaccagcggacc
gcagactgtgtggtcgccggttaccgtctccacaaatcaggcccggatgcggtcggctcg
ctgctgctcgggctctacacagatgacggcgagctggcctccgtcggtgtcatcggcgcc
ttctcgatggagcggcgacggcagctgttcgccgaattacagccgctgataaccagtttc
gagaaccatccatggaactgggccgagcaggtggcggcagatccggacctcgcccgtcga
tacggcggcggctcacgctggaacgccggcaaggatctgtccttcgtaccgctgcggccc
gaacgtgttgtcgaggtccgctacgaccacatggaaggcagacggttccggcacaccgcc
cagttcaaccgctggcggcccgaccgcgacccacggtcgtgcacctacgcccagctggag
cagccggtcaccttcgggctcaacgacatcgtgccgggcctgctcccggactaa

DBGET integrated database retrieval system