KEGG   Mycobacterium sp. VKM Ac-1817D: G155_28790Help
Entry
G155_28790        CDS       T03634                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Brite
Enzymes [BR:myv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     G155_28790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIY48848
UniProt: A0A0A1FVX4
LinkDB All DBs
Position
6033579..6034202
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDYDYGALEPHISGQINELHHSKHHAAYVKGVNDAVAKLDEARANGDHAAIF
LNEKNLAFHLGGHVNHSIWWKNLSPNGGDKPTGDLAAAIDDQFGSFDKFQAQFTAAANGL
QGSGWAVLGYDSLGDRLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWEDVQNRYAAATSKTNGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacactttgccggacctggattacgactacggagcactggagccccacatc
tcggggcagatcaacgagctccaccacagcaagcaccacgccgcgtacgtcaagggcgtc
aacgacgccgtggccaagctcgatgaggcgcgggccaacggtgaccacgcggcgatcttc
ctcaacgagaagaacctggcgttccatctcggcggccacgtgaaccactcgatctggtgg
aagaacctgtcccccaacggtggtgacaagccgacgggcgatctggccgcggcgatcgac
gatcagttcggctcgttcgacaagttccaggcgcagttcaccgccgccgccaacgggctg
cagggctcgggctgggccgtgctcggctacgacagcctgggcgatcggctgctgaccttc
cagctctacgaccagcaggccaacgtgccgctcggcatcatcccgctgctccaggtcgac
atgtgggagcacgccttctacctgcagtacaagaacgtcaaggccgactacgtcaaggcg
ttctggaatgtcgtgaactgggaggatgtgcagaaccgctacgctgcggccacttccaag
accaacggcctgatcttcggctag

DBGET integrated database retrieval system