KEGG   Mycobacterium sp. VKM Ac-1817D: G155_30020Help
Entry
G155_30020        CDS       T03634                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Brite
KEGG Orthology (KO) [BR:myv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    G155_30020
Enzymes [BR:myv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     G155_30020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like Glutaredoxin FAD_binding_3 Thi4 DAO K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIY49921
LinkDB All DBs
Position
6280566..6282164
Genome map
AA seq 532 aa AA seqDB search
MLDTSLAGQLKSLLERLTVPIELVSSLDDGPKSAELAELLTEIAAMSDKISYSRADDDAR
RPSFVIRRTGTDVEVRFAGIPLGHEFSSLALALLQVGGYPSKEAPELLEQVRNLGAGGAG
NPAGADLHFETYFSLSCQNCPDVVQALNLMAILNPRISHVAIDGALFKDEVEQRKVLAVP
TVFLNGELFDSGRMTLEQIIGKVDTGAAHRTAEAITEKDPFDVLVVGGGPAGAAAAIYAA
RKGIRTGVVAERFGGQVLDTMAIENYISVPHTEGPKYAAALEAHVGEYDVDVMKTQRGAK
LLPAIDEGGLIEISLESGASLTARTVILATGARWRAMDVPGEAEYRNKGVTYCPHCDGPL
FKGKRVAVVGGGNSGVEAAIDLAGVVSHVTLIEFDSVLRADEVLQRKLRSLPNVDILLST
LTTEVLGDGDQVTGLTYQDRTTGQSHNLELQGVFVQIGLLPNTEWLEGSVELSKRGEIVI
DERGQTSVPGVFAAGDCTTVPFKQIVIAAGAGATAALSAFDHLIRTTAPVSG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacctcactcgccggccaattgaagtccctgctggagcggctgaccgtgccg
atcgagctggtgtcctccctcgatgacggtcccaagtccgccgaactcgccgaactgctc
accgagatcgcggcgatgtcggacaagatcagctattcgcgcgccgacgacgatgcccgg
cggccgtccttcgtcattcgccgcaccggcaccgacgtcgaggtccggttcgccggcatc
ccgctgggccacgagttctcctcgctggcgctggcactgctgcaggtcggcggctacccg
tcgaaggaagcccctgagctgctcgagcaggtccgcaacctcggcgccggcggggccggc
aatccggccggcgcagacctgcatttcgagacctacttctcgctgtcctgccagaactgc
cccgacgtggtgcaggcgctgaacctgatggcgatcctcaacccgcgcatcagccacgtc
gccatcgacggcgcgctgttcaaggacgaggtcgaacagcgcaaggtgctggcggttccc
accgtcttcctcaacggtgagttgttcgactccggccgtatgacgctggagcagatcatc
gggaaggtcgacaccggcgccgcgcatcgcaccgccgaggcgatcaccgagaaggacccc
ttcgacgtgctggtggtcggcggcggacccgcaggggcggcggccgcaatctacgctgcc
cgcaagggaattcgcaccggcgtggtcgccgagcggttcggcggtcaggtgctcgacacc
atggcgatcgagaactacatctccgttccgcacaccgagggaccgaagtacgccgcggca
ctggaagcccacgtcggcgagtacgacgtcgacgtgatgaagacccagcgcggcgcgaag
ctactgcccgcgatcgacgagggcgggctcatcgagatctcgctggagagcggtgcctcg
ctgaccgcgcggaccgtcatcctcgcgaccggtgcccgctggcgcgcgatggatgtgccg
ggtgaggccgagtaccgcaacaagggtgtcacctactgcccgcactgcgacggaccgctg
ttcaagggcaagcgtgtcgccgtagtcggcggcggcaactccggcgtggaggccgcgatc
gacctggccggcgtcgtctcccacgtgacgctgatcgaattcgactcggtgctgcgcgcc
gacgaggtgctgcagcgcaagctccgcagcctgcccaacgtcgacatcctgctgagcacg
ctgaccaccgaggtcctcggcgacggcgaccaggtgaccggactgacctaccaggaccgc
accacgggccagtcacacaacctcgagctgcagggcgtcttcgtccagatcggactgctg
cccaacaccgagtggctggaaggcagcgtcgaactgtccaaacgcggcgagatcgtcatc
gacgagcgcggccagacgtcggtcccgggtgtgttcgccgccggtgactgcaccacggtg
ccgttcaagcagatcgtcatcgccgccggagccggcgcgacggcagcgctgtccgcgttc
gatcacctgatccggaccaccgcccccgtcagcggctga

DBGET integrated database retrieval system