KEGG   Myroides sp. ZB35: BK054_00160Help
Entry
BK054_00160       CDS       T04543                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
myz  Myroides sp. ZB35
Pathway
myz00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:myz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BK054_00160
Enzymes [BR:myz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BK054_00160
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BK054_00160
    1.1.1.-  
     BK054_00160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 adh_short HI0933_like 2-Hacid_dh_C 3HCDH_N FAD_binding_3 FokI_C FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: APA90695
LinkDB All DBs
Position
complement(37435..38502)
Genome map
AA seq 355 aa AA seqDB search
MSTMKAARWYAAKDIRVEQTEIPTPAKGQVKVAVQYAGICGSDLHEYVHGPQLIPLDKPY
PLNGHQGVTTLGHEFSGIVEELGEGVKNIKVGDRVVIEPIYKNFDSPFVASGEYNLGEHL
GFIGLAGNGGFAKYVVVEDYMIHKIPDTMSFEQGALVEPAAVAVYSVLQSGLKVGQTVLV
SGAGPIGLLCAQAALAAGASTVIVTDVAEKRLEKAKEIGATHVFNAMEADLPAKIKALTG
GLGVNVFLDCAGVQASYNTGIASTRNGGTAVLVALFGKPVQHDALDQVLREITVKGVIAY
RNIFPEVINLIDSGRMEVEKLVTNKIGLDEIVTNGFEALVSNPEQVKILIDINRA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaatgaaagcagcacgctggtatgcagccaaagatattagagtagaacaaaca
gaaatccctactccagctaaaggacaggtaaaagtagcagttcaatatgctggtatctgt
ggatcagacttacacgaatatgtacacgggcctcaattaattccattagacaaaccttat
ccattaaatggtcatcagggtgtaactactttaggacatgagttctcaggtatcgttgaa
gaattaggtgaaggtgtaaaaaatattaaagtaggggatcgtgtagtaattgagcctatc
tataaaaacttcgatagtccattcgtagcttctggagaatacaacttaggagaacactta
ggtttcatcggattagcaggtaatggaggatttgcaaaatacgtagtggttgaagattat
atgattcacaaaattcctgatacgatgtcttttgaacaaggtgctttagtagagcctgct
gcagtagctgtatactcagtactacagagtggtctaaaagtaggacagacagtattagta
tctggtgcaggacctatcgggttactatgtgctcaagcagctttagcagctggtgcgtct
actgtgatcgttacagatgtagcagagaaacgcttagagaaagcaaaagaaatcggagct
actcatgtattcaatgctatggaagctgatcttcctgctaagattaaagccttgactggt
ggtctaggagttaatgtattcttagattgtgctggagtacaagcttcttataatacaggt
attgcttctactcgtaatggaggtactgctgtattagttgctttattcggaaaaccagtt
caacacgatgctttagatcaagtattaagagagatcactgtaaaaggggttatcgcttat
agaaatatcttccctgaagtaattaacttaatcgactctggtcgtatggaggtagaaaaa
ttagtgacaaataaaattggtttagacgagattgtaacaaatggttttgaagccttagta
agcaatccagaacaagttaaaatccttattgatatcaatagagcataa

DBGET integrated database retrieval system