KEGG   Myroides sp. ZB35: BK054_00815Help
Entry
BK054_00815       CDS       T04543                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
myz  Myroides sp. ZB35
Pathway
myz00230  Purine metabolism
myz00240  Pyrimidine metabolism
myz01100  Metabolic pathways
myz01110  Biosynthesis of secondary metabolites
myz01130  Biosynthesis of antibiotics
Module
myz_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
myz_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
myz_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:myz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BK054_00815
   00240 Pyrimidine metabolism
    BK054_00815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:myz04131]
    BK054_00815
Enzymes [BR:myz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BK054_00815
Membrane trafficking [BR:myz04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BK054_00815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: APA90817
LinkDB All DBs
Position
199318..199737
Genome map
AA seq 139 aa AA seqDB search
MATNRTFTMIKPDAVEAGNIGGIINMITEGGFKIVSMKLTQLTVRDAQKFYEVHSERPFY
GELVEFMSRGPIVAAILEKENAVEDFRKLIGATNPAEAAEGTIRKKYAKSIGENAVHGSD
SDENAAIESAFHFSGREQF
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgaacagaacttttacaatgattaaacctgatgctgtagaagcaggtaacatc
ggtggaatcatcaacatgattactgaaggaggatttaaaatcgtttcaatgaagttaact
caattaactgtaagagacgctcaaaaattctatgaagtacacagtgaaagacctttctac
ggagaattagttgaattcatgtctagaggtccaatcgtagcagctatcttagaaaaagag
aacgctgtagaagatttcagaaaattaatcggtgctactaacccagctgaagctgctgaa
ggtactatccgtaaaaaatatgcaaaatcaatcggtgaaaacgcagtacatggatctgat
agcgacgagaacgctgctatcgagtctgctttccacttctcaggaagagagcaattctaa

DBGET integrated database retrieval system