KEGG   Myroides sp. ZB35: BK054_02910Help
Entry
BK054_02910       CDS       T04543                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
myz  Myroides sp. ZB35
Pathway
myz00010  Glycolysis / Gluconeogenesis
myz00020  Citrate cycle (TCA cycle)
myz00620  Pyruvate metabolism
myz01100  Metabolic pathways
myz01110  Biosynthesis of secondary metabolites
myz01120  Microbial metabolism in diverse environments
myz01130  Biosynthesis of antibiotics
myz01200  Carbon metabolism
Module
myz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:myz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BK054_02910
   00020 Citrate cycle (TCA cycle)
    BK054_02910
   00620 Pyruvate metabolism
    BK054_02910
Enzymes [BR:myz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BK054_02910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 GCV_H PYNP_C HlyD_3
Motif
Other DBs
NCBI-ProteinID: APA91193
LinkDB All DBs
Position
complement(630812..632425)
Genome map
AA seq 537 aa AA seqDB search
MAEVITMPRLSDTMTEGVVAAWLKKVGDKISEGDILAEIETDKATMEFESFNSGTLLYIG
LQEGESAPVDSLLAIIGNEGEDISALISGAGNAAPAAEAAAPVVEAKVETPAPAVAAMPA
GVKIITMPRLSDTMTDGTVATWIKKVGDKVQEGDILAEIETDKATMEFEAFEAGTLLYIG
INEGESAPVDSVLAILGPEGTDVSAVVASAQNGGTFAAEAPATEAPKAEEPKTVNVEAAT
STNGRVFISPLAKKIAEDKGINITEVKGSGENGRIIKRDIENYTPAAKTAAPEAAATAAV
PAVKAFVPAGEVSVEEVKNSQMRKTIARRLAESKFTAPHYYLTIELDMDNAIESRKIINN
LPDTKVSFNDMVVKACAMALRKHPQVNTQWTDNATIYNNHINIGVAVAVEDGLVVPVLPF
TDQMSLTHIGGKVKELAGKAKTKKLTPAEMDGSTFTVSNLGMFGIQSFTSIINQPNSAIL
SVGAIVEKPVVKNGQIVVGNTMTVTLACDHRTVDGATGAQFLQTFKDYVENPVTMLA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaattacaatgccacgcttaagcgacacgatgacagaaggtgttgttgca
gcatggttaaaaaaagttggagataagatttctgaaggagatatccttgcagaaattgaa
acagacaaagcaacaatggagtttgaatcatttaattcaggtacattgttatatattgga
ttacaagaaggtgaatctgctcctgtagattcgttacttgctattataggaaatgaaggt
gaagatatttctgctttaatcagtggtgcgggtaatgctgctcctgctgctgaggctgct
gctcctgtagtagaggctaaagttgaaacaccagctcctgctgtggctgctatgcctgct
ggagttaaaatcattactatgcctcgtcttagtgatactatgactgatggtacagtagct
acttggattaaaaaagtaggtgataaggttcaggaaggagatatccttgcagaaatcgaa
actgataaagctactatggagttcgaagcttttgaggctggaactttattatatattggt
attaacgaaggtgagtctgctcctgttgatagcgtattagcgatcttaggaccagaagga
actgacgtatcagctgtagttgcatctgctcaaaacggtggtactttcgctgctgaggct
cctgctacggaggctcctaaagctgaagaaccaaaaactgtaaacgtggaggctgctact
tctactaatgggagagtattcatttctccattggctaagaaaattgctgaagataaagga
ataaatattactgaggtgaaaggttcaggtgagaatggacgtatcatcaaacgcgatatt
gaaaactatacacctgctgctaaaactgctgctcctgaagctgcagctactgctgctgta
cctgctgttaaggcattcgtaccagctggagaagtaagtgtagaggaagtgaaaaactca
caaatgcgtaaaactattgctcgtcgtttagctgagtctaagtttactgctcctcattac
tatttaactatcgagttagatatggataatgctattgagtctcgtaagattatcaataac
ttacctgatacgaaagtgtcgtttaacgatatggtagtgaaagcatgtgctatggcactt
cgcaaacaccctcaggtgaatacacaatggactgataatgcaactatctataacaaccac
atcaatatcggtgtagctgtagctgtagaggatggattagtagtaccagtattaccattc
acagatcagatgtctttaactcatatcggtggtaaagtaaaagaattagctggtaaagct
aagactaaaaaacttactcctgctgagatggatggaagtacattcactgtgtctaactta
ggtatgtttggtattcagtcatttacttctattattaaccaaccaaactctgcaattcta
tcagtaggtgctattgtagaaaaaccagtagtgaagaatggtcaaatcgtagtaggtaat
acaatgacagtaactctagcatgtgaccacagaactgtggacggtgctacaggtgctcag
ttcttacaaacatttaaagattatgtagagaacccagtgactatgttggcgtaa

DBGET integrated database retrieval system