KEGG   Myroides sp. ZB35: BK054_04925Help
Entry
BK054_04925       CDS       T04543                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
myz  Myroides sp. ZB35
Pathway
myz00010  Glycolysis / Gluconeogenesis
myz00053  Ascorbate and aldarate metabolism
myz00071  Fatty acid degradation
myz00280  Valine, leucine and isoleucine degradation
myz00310  Lysine degradation
myz00330  Arginine and proline metabolism
myz00340  Histidine metabolism
myz00380  Tryptophan metabolism
myz00410  beta-Alanine metabolism
myz00561  Glycerolipid metabolism
myz00620  Pyruvate metabolism
myz00625  Chloroalkane and chloroalkene degradation
myz01100  Metabolic pathways
myz01110  Biosynthesis of secondary metabolites
myz01120  Microbial metabolism in diverse environments
myz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:myz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BK054_04925
   00053 Ascorbate and aldarate metabolism
    BK054_04925
   00620 Pyruvate metabolism
    BK054_04925
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BK054_04925
   00561 Glycerolipid metabolism
    BK054_04925
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BK054_04925
   00310 Lysine degradation
    BK054_04925
   00330 Arginine and proline metabolism
    BK054_04925
   00340 Histidine metabolism
    BK054_04925
   00380 Tryptophan metabolism
    BK054_04925
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BK054_04925
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BK054_04925
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BK054_04925
Enzymes [BR:myz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BK054_04925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APA91563
LinkDB All DBs
Position
1087722..1089269
Genome map
AA seq 515 aa AA seqDB search
MTTSNNQFGISEVLEKLGLVAENNGSSTGLNSFSNGRIIESYSPVDGQLIGKVKASTKED
YQKVMATAEEAFKSWRLVPAPKRGEIVRQIGEELRNKKEYLGKLVSYEMGKSLQEGLGEV
QEMIDICDFAVGLSRQLYGLTMHSERPMHRMYEQWHPIGVVGVISAFNFPVAVWSWNTMI
AWVCGDVCIWKPSSKTPLCGVACQNIVAGVFKKNNIPEGVCNLVIGNECGDLINTDPRIP
LVSFTGSTRIGRHVSKTVAERFGNTILELGGNNAIIVSEHADINMVLVGAVFGAVGTAGQ
RCTSTRRLIVHESVYDKTVDVLQKAYAQLKIGNPLDATNHVGPLIDKAAVKDYLDAIEKA
KAEGGKVIVEGGVLEGAGYESGCYVKPCIIEGKNTYEIIQAETFAPILYIMKYKDIEEAI
AMQNGVPQGLSSSIFTNSMREMELFLSHAGSDCGIANVNIGTSGAEIGGAFGGEKETGGG
RESGSDAWKAYMRRQTNTINYGTELPLAQGIKFDF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatctaataaccaatttggtatttcggaagtattagaaaaattaggactcgtg
gcagagaacaatggttcttctacaggtcttaattctttttctaacggtaggattatagaa
tcttattctcctgtagacggtcaacttatcggaaaagtaaaagcttctacaaaagaagat
taccaaaaagtaatggctactgcagaggaggcttttaaaagctggagactagtacctgct
cctaaacgaggcgaaatcgtaagacaaataggtgaagaacttcgaaataaaaaagaatac
ttaggcaagctagtatcatacgagatgggaaaaagccttcaagaaggtctaggtgaggta
caggagatgatcgacatctgtgacttcgcagtaggtctatctcgtcagttatacggacta
acgatgcattctgagcgccctatgcaccgtatgtatgagcagtggcaccctatcggagtg
gtaggtgttatctctgcatttaacttcccggtagcagtatggagttggaataccatgatc
gcatgggtatgtggtgatgtgtgtatctggaaacctagttctaagacaccattatgtggt
gtagcgtgtcagaatatcgtagctggcgtattcaagaaaaacaatatccctgaaggtgta
tgtaacctagttatcggtaatgagtgtggtgatctaatcaacacggatcctagaatccct
ctagtgtcattcacggggtctactcgtataggtagacatgtatctaagactgtagcagaa
cgcttcggtaatactatcctagagcttggaggtaataatgctatcatcgtatctgagcat
gctgatatcaacatggtattagtaggggctgtattcggagctgtaggtactgcaggacag
cgctgtactagtacgagaaggctgatcgtacacgagagcgtatatgataaaacagtagat
gtactacaaaaggcgtatgcacaattaaaaatagggaacccattagacgctactaatcac
gtaggaccacttatcgataaagcagctgtaaaagattacttagacgctatagaaaaggca
aaagctgaaggtggtaaggtcatcgtagaaggtggtgtactagaaggtgctgggtatgag
agtggatgttatgtaaaaccgtgtatcatagaaggtaagaatacttacgaaattatacag
gctgagacattcgcacctatcttatacatcatgaagtacaaagatatcgaagaggctatc
gctatgcaaaacggggtgcctcaagggctatcttcttctatcttcacgaatagtatgaga
gaaatggagttattcttatctcatgcaggctctgactgtggtatcgctaatgtgaatatc
ggtacatctggtgctgagatcggaggcgcattcggaggtgagaaagagactggtggagga
agagagtctgggtcagacgcgtggaaagcttatatgagaagacagacgaatacaatcaac
tatggtacagagttaccattagcacaaggtattaaatttgacttctag

DBGET integrated database retrieval system