KEGG   Myroides sp. ZB35: BK054_11005Help
Entry
BK054_11005       CDS       T04543                                 

Definition
(GenBank) RNA methyltransferase
  KO
K07444  putative N6-adenine-specific DNA methylase [EC:2.1.1.-]
Organism
myz  Myroides sp. ZB35
Brite
KEGG Orthology (KO) [BR:myz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BK054_11005
Enzymes [BR:myz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     BK054_11005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 THUMP AviRa
Motif
Other DBs
NCBI-ProteinID: APA92733
LinkDB All DBs
Position
complement(2447862..2449010)
Genome map
AA seq 382 aa AA seqDB search
MVAKTFFGFEEVLAKELQLLGALNVQQGTRMVSFKGDKGFMYKANLSLRTALKILKPIAT
FAVYNEANLYKGVQSIDWSEYLSANQSFVIDATVFSDNFNNSQFVALKAKDAIVDQFRNK
SGVRPSIDKDYPDLRINVHLQKDLCTISLDSSGASLHHRGYRTATNIAPINEVLAAGMLL
MSGWDGRSDFMDPMCGSGTILTEAAMIACNIPANINRKEFAFERWNDWDAELFDKVQESL
LKRIREFHYTIKGYDKAPSAVLKAIDNVRNANLDEYIEIKTANFFDTQKETEGPLHMVFN
PPYGERLDIDLERFYREVGDTLKQGYPGTEAWFITGNVEALKFVGLRPSRKIKLYNGKLE
ARLVKYELYEGSKKGKYINKND
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaagaccttcttcggttttgaagaagtactagcaaaagaattacaattatta
ggtgcattaaatgtacaacagggtactagaatggtaagttttaaaggagataaaggtttt
atgtataaagccaatctatctctgcgtacagctttaaaaatcctaaaacctattgctact
tttgcagtatataatgaagcaaacttatataaaggtgttcaaagtattgactggagtgag
tatctatcagctaatcagtccttcgtaatagacgctacagtattctctgataactttaac
aactctcaattcgttgcgttaaaagcaaaggatgctatcgtagatcagtttagaaataaa
agtggagtacgcccaagtatagataaagattatccggacttaagaattaacgtccactta
caaaaagacctgtgtacaatatctctagattcgtcaggagcctctctacaccaccgtgga
tatagaacagctactaatatcgctcctatcaatgaagtgttagcagcaggaatgttatta
atgtcaggatgggatggtagaagtgattttatggatccaatgtgtggttctggtacaatc
ttaacagaagcggctatgatcgcttgtaatatccctgcaaatatcaatagaaaagagttt
gcttttgaaagatggaatgattgggatgcagagctttttgacaaggtacaagagtcgcta
ttaaaaagaatacgcgagttccattatacaataaaaggatacgataaggcaccttctgca
gtattaaaagcgatagataacgtaagaaatgctaacttagacgaatatatcgagataaaa
actgcgaacttcttcgatactcaaaaggaaactgaaggcccactacacatggtgtttaac
cctccttatggagaacgtctagacatagatctagaacgcttctacagagaagtaggtgat
acattaaaacaaggataccctggcacagaagcttggtttatcacaggtaatgtagaagcc
ttaaaattcgtaggattaagaccttctagaaagataaaactatacaatggaaaactagaa
gctcgtttagtaaaatatgaactatacgaaggaagtaaaaaaggaaaatatattaataaa
aatgattaa

DBGET integrated database retrieval system