KEGG   Methylorubrum zatmanii: B2G69_04455Help
Entry
B2G69_04455       CDS       T04981                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
mza  Methylorubrum zatmanii
Pathway
mza00910  Nitrogen metabolism
mza02010  ABC transporters
Module
mza_M00438  Nitrate/nitrite transport system
mza_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:mza00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    B2G69_04455
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    B2G69_04455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mza02000]
    B2G69_04455
Transporters [BR:mza02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    B2G69_04455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ARO53469
UniProt: A0A1W6RF42
LinkDB All DBs
Position
complement(1000138..1000995)
Genome map
AA seq 285 aa AA seqDB search
MATGATLTATRERAAKARTPFITMAGLRGVAARVLPPLVVLAGFLLLWEVLCSSPTAGLP
PPSRVVTEAWDIIIDPFYDNGGTDKGLFWHIAASLKRVALGFSLAVVAGVMLGTLVGQSD
WAMRGLDPIFQILRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSIWPIIINTAVGIRNIP
QDYRNVAAVIRLNPIEFFVKIMLPSAAPYIFTGLRIGVGLSWLAIVAAEMLIGGVGIGFF
IWDAWNSSHISEIIVALVYVGLIGFVLDRMVAGLGVLVTRGTSAA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctaccggagcaacgctcaccgcaacccgcgaacgtgccgccaaggcccgcacgccc
ttcatcaccatggccgggctgcgcggcgttgccgcccgcgtcctgccgccgctcgtcgtc
ctggcgggcttcctgctcctgtgggaggtgctgtgctcctcccccaccgccggcctgccg
ccgccctcgcgggtggtgacggaagcctgggacatcatcatcgatccgttctacgacaac
ggcggcaccgacaagggcctgttctggcatatcgccgcgagcctgaagcgcgtggcgctg
ggcttctcgctggcggtggtggcgggcgtgatgctcggcacgctggtcggccagtccgac
tgggcgatgcgcgggctcgacccgatcttccagatcctgcgtacgatcccgccgctggcg
tggctcccgctctcgctggccgccttccgcgacggccaacccagcgcgatcttcgtgatc
ttcatcacctcgatctggccgatcatcatcaacaccgcggtcggcatccgcaacattccg
caagactaccgcaacgtcgccgcggtcatccggctgaacccgatcgagttcttcgtgaag
atcatgctgccctcggcggccccctacatcttcaccggtcttcgcatcggcgtcggcctg
tcctggctcgccatcgtcgcggccgaaatgctgatcggcggcgtcgggatcggcttcttc
atctgggacgcgtggaactcgtcgcacatctccgagatcatcgtcgccctcgtctatgtc
gggctcatcggcttcgtcctcgaccggatggtcgccgggctcggcgtgctcgtgacccgc
ggcaccagcgcagcgtga

DBGET integrated database retrieval system