KEGG   Methylorubrum zatmanii: B2G69_22300Help
Entry
B2G69_22300       CDS       T04981                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mza  Methylorubrum zatmanii
Pathway
mza00473  D-Alanine metabolism
mza00550  Peptidoglycan biosynthesis
mza01100  Metabolic pathways
mza01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mza00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B2G69_22300
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B2G69_22300
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B2G69_22300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mza01011]
    B2G69_22300
Enzymes [BR:mza01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B2G69_22300
Peptidoglycan biosynthesis and degradation proteins [BR:mza01011]
 Precursor biosynthesis
  Amino acid ligase
   B2G69_22300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: ARO56602
UniProt: A0A1W6RNZ3
LinkDB All DBs
Position
4830957..4831880
Genome map
AA seq 307 aa AA seqDB search
MSKHVAVLMGGWSSEREISLRSGNACAEALEGEGYRVTRVDVGPDIATVLTDLRPDAALN
ALHGPAGEDGTIQGLLEILKIPYTHSGVLASALAMHKERAKTVMRAAGVSVPEGRVVNRH
DAAKSHPLTPPYVVKPIAEGSSMGVIIVRDERSHPPQILASDEWVYGEEVLAETYVAGRE
LTCAVLGDRALGVTEIKPVSGEWYDFDAKYAGGGSIHVLPADLKLNIYQRVQELALTAHQ
ALGCRGVSRADLRYDDTPGGTGALVVLEVNTQPGMTQTSLVPEIAAHAGQSFGELVRWMV
EDASLNR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcacgtcgccgtcctcatgggcggctggtcttccgagcgggaaatctcgctt
cgctccggcaatgcctgcgccgaagcgctggaaggggaggggtatcgcgtcacccgcgtc
gatgtcgggcccgacatcgcgacggtgctgaccgatctgcggcccgacgcggcgctcaac
gcgctccacggcccggccggcgaggacggcacgatccagggcctcctggagatcctgaag
atcccctacacccattccggcgtgctggcctcggcgctcgccatgcacaaggaacgtgcc
aaaacggtcatgcgcgcggccggagtcagcgttccggagggccgggtcgttaaccgtcat
gatgcggcgaagtcacacccgttaacccctccctatgtcgtgaagccgatcgccgagggc
tcctccatgggggtcatcatcgtgcgtgacgagcgctcgcacccgccccagattctcgcc
tccgacgagtgggtctacggcgaggaagtccttgcagagacttacgttgcgggccgcgag
ctgacctgcgcggtgctgggcgaccgggccctcggagtcaccgagatcaagcccgtctcg
ggggagtggtacgacttcgatgcgaagtacgccggaggggggtcgatccacgtcctcccc
gcggatcttaaactaaatatttaccagcgtgtccaagagttggcgttaacggcgcatcaa
gcactgggatgtcgtggcgtcagccgtgccgaccttcgttacgacgacacgccgggtgga
accggcgctctcgtcgtcctcgaggtcaacacgcagccagggatgacccagacgagcctt
gtgccggagatcgcggcccacgcaggccagagtttcggtgaactcgtccgatggatggtg
gaggacgcttctctcaaccgctga

DBGET integrated database retrieval system