KEGG   Methylorubrum zatmanii: B2G69_23220Help
Entry
B2G69_23220       CDS       T04981                                 

Definition
(GenBank) thiol:disulfide oxidoreductase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
mza  Methylorubrum zatmanii
Brite
KEGG Orthology (KO) [BR:mza00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B2G69_23220
Enzymes [BR:mza01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     B2G69_23220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ARO56777
UniProt: A0A1W6RPR6
LinkDB All DBs
Position
complement(5022688..5023395)
Genome map
AA seq 235 aa AA seqDB search
MIDLHYWPTPNGHKVTMFLEEAGLPYTIHPVDIGKGAQFEPAFLKIAPNNRMPAIVDHEP
ADGGAPVSLFESGAILLYLAEKTGRFLPADLGGRAETLQWLFWQMGGLGPMLGQNHHFSQ
YAPEKIPYAIDRYVKETNRLYGVLDRRLADRAFVAGPDYTIADMASYPWIVPWEKQGQRL
DDHPNLKRWFEAIAERPATKAAYARAVEANPNHGQPMSEDAKKVMFGQTATNTKR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctgcattactggccgaccccgaacggtcacaaggtgacgatgtttctggag
gaggccggcctcccctacacgatccacccggtggatatcggcaagggtgcgcagttcgag
ccggccttcctgaagatcgccccgaacaaccggatgccggccatcgtcgatcacgagccg
gccgatggcggtgcgccggtctcgctgttcgagtcgggcgcgatcctgctctacctcgcg
gagaagaccgggcgcttcctgcccgccgacctgggcggccgggccgagaccctgcaatgg
ctgttctggcagatgggcggcctcgggccgatgctgggccagaaccaccatttctcgcaa
tacgcgccggagaagatcccctacgccatcgaccgctacgtcaaggagacgaaccggctc
tacggcgtgctcgaccggcggctcgccgaccgcgccttcgttgcgggccccgactacacc
atcgccgacatggcttcctatccctggatcgtgccgtgggagaagcagggccagcgcctc
gacgaccaccccaacctgaagcgctggttcgaggcgatcgccgagcgccccgccaccaag
gccgcctatgcgcgggcggtggaagccaacccgaaccacggccagccgatgagcgaggac
gcgaagaaggtgatgttcggccagaccgcgacgaacaccaagcgctga

DBGET integrated database retrieval system