KEGG   Methylorubrum zatmanii: B2G69_24675Help
Entry
B2G69_24675       CDS       T04981                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mza  Methylorubrum zatmanii
Pathway
mza00010  Glycolysis / Gluconeogenesis
mza00620  Pyruvate metabolism
mza01100  Metabolic pathways
mza01110  Biosynthesis of secondary metabolites
mza01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mza00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2G69_24675
   00620 Pyruvate metabolism
    B2G69_24675
Enzymes [BR:mza01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     B2G69_24675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ARO57039
UniProt: A0A1W6RQB1
LinkDB All DBs
Position
5335932..5337455
Genome map
AA seq 507 aa AA seqDB search
MNKPEFLADAKTKSPFSARYDNFIGGQWVAPASGRYFENTSPITGKVICEVARSEAADIE
RALDAAHAAKDAWGRTAPAERARILNKIADRMEDNLDLIALAETWDNGKPIRETTAADIP
LAIDHWRYFASCVRAQEGAISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAI
AAGNCVVLKPAEQTPASILVVMELIGDLLPPGVINVVNGFGLEAGKPLASNPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFGDVVNEDDDFFDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFIERAIKRVEAITQGSPLDPATMIGAQASSEQLEKILSYVDIG
RQEGAECLTGGARGTREGDLADGFYMQPTVFKGHNKMRIFQEEIFGPVLSVTTFKDDEEA
LSIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNMLVSYSSKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcccgaattcctggcggatgccaagacgaagtcgccgttttcggcgcgctac
gacaacttcatcggcggccagtgggtcgcgccggcgagcggccgctacttcgagaacacg
tcccccatcaccggcaaggtgatctgcgaggttgcccgctccgaggcggcggacatcgag
cgggcgctcgacgccgcgcacgccgccaaggatgcctggggccgcaccgcgccggccgag
cgcgcccgcatcctcaacaagatcgccgaccggatggaggacaacctcgatctgatcgcg
ctggccgagacctgggacaacggcaagccgatccgcgagaccaccgccgccgacatcccg
ctcgccatcgaccactggcgctacttcgcgagctgcgtccgcgcccaggaaggcgcgatc
tccgagatcgaccacgacacggtggcctaccacttccacgagccgctcggcgtcgtcggc
cagatcatcccgtggaacttcccgatcctgatggcggtgtggaagctggcccccgcgatc
gccgccggcaactgcgtggtgctcaagcccgccgagcagacccccgcctcgatcctcgtg
gtgatggagctgatcggcgacctgctgccgccgggcgtcatcaacgtcgtcaacggcttc
ggcctggaggccggcaagccgctcgcctcgaacccgcgcatcgccaagatcgccttcacc
ggtgagacgaccaccggccgcctcatcatgcagtacgcctcgcagaacctgatcccggtg
acgctggagctgggcggcaagtcgccgaacatcttcttcggggatgtcgtcaacgaggac
gacgacttcttcgacaaggcgctcgaaggcttcaccatgttcgccctcaaccagggcgaa
gtctgcacctgcccgagccgcgcgctcgtgcacgagtcgatctatgaccgcttcatcgag
cgcgcgatcaagcgcgtcgaggcgatcacccagggctcgccgctcgatccggcgacgatg
atcggcgcgcaggcctcctcggagcagctcgagaagatcctgagctacgtcgatatcggc
cgccaggaaggcgccgagtgcctcacgggcggcgcccgcggcacccgcgagggcgatctg
gccgacggcttctacatgcagccgacggtgttcaagggccacaacaagatgcggatcttc
caggaggagatcttcgggcccgtcctctcggtgacgaccttcaaggacgacgaggaggcg
ctctccatcgccaacgacacgctctacggcctcggcgccggcgtgtggacccgcgacgga
acccgcgcctaccgcttcggccgcgccatccaggccggccgcgtctggacgaactgctac
cacgcctacccggcgcacgcggccttcggcggctacaagcagtccggcatcggccgtgag
acccacaagatgatgctcgaccactaccagcagaccaagaacatgctggtcagctactcc
tcgaagaagctcgggttcttctaa

DBGET integrated database retrieval system