KEGG   Maylandia zebra (zebra mbuna): 101463583
Entry
101463583         CDS       T02814                                 

Gene name
pak5
Definition
(RefSeq) serine/threonine-protein kinase PAK 5 isoform X1
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101463583 (pak5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101463583 (pak5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101463583 (pak5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101463583 (pak5)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101463583 (pak5)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE20 family
   101463583 (pak5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 101463583
NCBI-ProteinID: XP_004542199
UniProt: A0A3P9BY04
LinkDB
Position
LG15
AA seq 782 aa
MAYPESFDWLKETVSLLPGLPGFSSMFGKKKKRLEISAPSNFEHRVHTGFDPREQKFTGL
PQQWQSLLADTANRPKPMVDPSYITPIQLAPMKISPKKVRSSETPLPKTIVRGNRPPKDA
SINGLLEEFDNISVTRSNSLRKESPPGPHQAGGISKPSGSGHLTAPEENGFNHYYSRYSC
DLDTSSRDFSLDPGKPSFSIDGDWALGRHYRFTKQNGHSHPIRSPFYPDAMPQKSDYGKL
PPDYHTYLESKGRSADEVASTVGSGVGSSGYYRASVGGSSSQDYRDTSVGTPSRASLHSE
QINYPDSEWSYGGMRDEYEKRPKSSYVTQTSPTPAIRQRSRSGSGLQEPNVPYAASGTFR
SPPQAHPYSSYTYPRLSESLANSQTLTKGDYERPSRDDSPQVAGGDTYPRGPLKLPQSHT
KPPGYPSVHLPYPPIFHHYKPSPYHHPPSQPSPPYTPQGAYSQPSSPYVPPGAYPPPSWG
SSSDTQPSRVSHEQFRAALQLVVNPGDPREYLDSFIKIGEGSTGIVCIATEKHSGKQVAV
KKMDLRKQQRRELLFNEVVIMRDYHHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTH
TRMNEEQIATVCLSVLKALSYLHTQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEV
PKRKSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRD
NLPPRLKESHKVSTVLRSFLDLMLVREPSQRATAQELLQHPFLKLSGPPSCIVPLMRHYR
HR
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggcctacccagagagctttgattggctgaaagagaccgtcagtttgttgccaggtttg
ccagggttttccagcatgtttgggaagaagaagaaacggctggagatctcagctccgtct
aacttcgagcaccgggtccacacgggcttcgacccacgggagcagaagttcaccggcctg
ccacagcaatggcagagcctcctggcagacactgccaatcggcccaagcccatggtggac
ccctcctacattacccccatacagctggcaccaatgaagatatctcccaagaaagtccgg
tcatccgaaacgccgttgcccaaaaccattgttcgagggaaccggccacccaaagatgca
tccattaacggcctgctggaggagttcgacaacatttcggtaacacgttccaactccctg
cgtaaagagagcccgccaggcccccatcaggctggaggcatctccaaaccctcgggcagt
ggccacctcactgctccagaggagaacggattcaaccactactactcccgctactcgtgt
gacctggacacgtccagcagggacttttctctggaccccggcaagccaagcttctccata
gatggggattgggcacttggcaggcactatcgattcaccaagcagaatggccactcacac
cccatacgcagccccttttaccctgatgccatgcctcagaaatcagactatggcaaactt
ccacctgactatcacacctatctggagagcaaagggcggtcggcggatgaggtggcctct
acggtgggtagcggagtaggttccagcggctactaccgggcatcggtggggggttcatcc
agccaggactaccgggacacatcagttggcacaccgtctcgtgcatcgctacacagcgag
cagattaactaccccgacagtgagtggagttacggcggcatgagggacgaatatgagaag
cgacccaagagttcctacgtgacccagaccagccccacgcctgccatcaggcagcgatct
cggtcaggctctgggctgcaggagccaaatgtcccctatgccgccagtgggactttcagg
agcccgccacaggcccacccgtacagctcctacacctaccctcgcctttcggagagtctc
gccaactcacagactttaaccaagggcgactatgagcgtccatcacgcgatgacagtccc
caggtcgcaggtggtgacacgtacccccgagggcctcttaagctacctcagagccacacg
aagccgcctggctacccctcggtgcacctgccgtaccccccgatctttcaccattacaaa
ccctctccttaccatcatcctccctcccagcccagtccaccatataccccgcagggggcc
tactcacagccttcgtcaccttacgtccccccaggggcttatccgcctccttcctggggg
tcaagctctgacacgcagccctccagagtttcccatgagcagttcagagcagcacttcag
ctggtggtcaaccctggcgaccctcgggaatacctggacagctttattaagattggcgag
ggatccacaggtattgtttgcatcgccaccgagaagcacagcggaaagcaggtggcagtg
aagaagatggacctcagaaaacagcagagaagagagctgctttttaacgaggtggtgatc
atgagggactaccatcatgaaaatgttgtggacatgtacaacagttacctggtgggagac
gagctttgggtcgtcatggagttcctggagggaggggcactcactgacattgtgactcac
accaggatgaacgaggagcagattgctacggtgtgtctgtcggtgttgaaggctctgtcc
tacctgcacacacagggcgtcatccaccgtgacattaagagcgactccattctcctgact
agcgatggcagaatcaagctatcagattttggcttttgtgcccaagtttccaaagaggta
cccaagaggaagtccctcgtgggcacaccctactggatggcaccagaggttatctcaaga
ttaccttacgggactgaggtggacatctggtctttaggcattatggtgattgagatggtg
gatggagagcccccttacttcaatgagccccctctgcaggccatgagaaggatacgagac
aacctgcccccacggctaaaggagtcccataaggtgtcaaccgtgttacgctccttcctg
gacctgatgctggtgagggaaccgtcccagagagccacagcgcaggagctcctccagcac
cccttcctaaagctctcgggacccccttcctgtatcgttcccctcatgagacactaccgc
catcgctga

KEGG   Maylandia zebra (zebra mbuna): 101464122
Entry
101464122         CDS       T02814                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 6 isoform X1
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101464122
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101464122
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101464122
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101464122
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101464122
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE20 family
   101464122
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 101464122
NCBI-ProteinID: XP_004572895
UniProt: A0A3P9CAH9
LinkDB
Position
LG15
AA seq 632 aa
MFQRRKKKHRLEISAPQDFQHRVHTSFDVTSGCYVGLPPQWQSVIDTLKRPRPLVDPSRI
TNVELGPKKTIVRGSFIGHGDYISHVISELTRMSVSSSNSLRRSSPSARKRARSMGRLGE
LAEDESYQYEELGHRGGSVKSGGSSTYWQDRIRQVRSDSSSPKLNGALQRAKSTCQVDSS
SETTPLKLDKPQRTGEPSGLYARSEGAELRNRTASYTVETNRHQVRLRPAVGHLPDLLFS
SRENSRRPHSSYDLQLASPSSRLLPPPNSTSSPIITGRAVFQRLPRPSSAFNAPIKSPNL
TTEDSPSQPHSPPTGSPGHAVASNQQAGSDGGPPKVTHEQFKEALQMVVDPGDPRMTLEN
FVKIGEGSTGVVCIAREKYSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYRHQNVVEMYR
SALVEDELWVIMEYLQGGALTHIVSETRLNEEQIATVCEGVLRALSYLHSQGVIHRDIKS
DSILLTLDGKIKLSDFGFCAQISKEVPKRKSLVGTPYWMAPEVIAKMPYGTEVDIWSLGI
MVVEMVDGEPPYFSDTPITAMKKLRDEAVPSVKNVQRVSPVLKDFLGCMLTRDTLQRSSA
ADLLEHPFMLQAGSPRCLVPLVEQYRKRMSLC
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgttccaacgcaggaagaagaagcacaggctggagatctcggcgccacaggacttccag
caccgcgtccacacgtcgtttgatgtcacctcgggatgctacgtggggctgccgccgcag
tggcagagcgtcatcgacacgctgaagaggccacgccccctggtggacccctccaggatc
accaatgttgaactaggacccaaaaagaccatcgttcgtggcagcttcatcggccatgga
gactacatcagtcatgtgatctctgagttgactcgtatgtcggtcagcagttccaactct
ctgcgccggagcagtccgtcggcacggaaacgtgcccgatcgatgggccggctgggagaa
ctggccgaggacgagtcgtaccagtacgaggagctaggtcaccgcggcggcagtgtgaaa
agtggtgggagctctacctactggcaggaccggatacgacaggtgcgcagcgacagcagc
agccccaaactgaatggggccctgcagagagccaagtctacctgccaggtggattcctcg
tctgaaaccacaccccttaaactagacaaacctcagaggacaggtgaaccaagtggactg
tacgcccgcagtgagggggcggaactaagaaataggacagcttcctacactgtggagacc
aataggcaccaggtgaggctaagaccagctgtgggtcacctgcctgacctgctgttctca
tccagagaaaattcaagaagaccgcattcgtcctacgacctccagctggcctcaccctcc
tcccgcctcctgcctcctcctaacagcaccagcagtcccatcatcacaggtagagctgta
tttcagaggctgcctcgcccatcctctgcctttaatgctcctatcaaatctccaaactta
acaactgaggacagcccctcccagccccactctcccccaactggctccccaggtcacgca
gtcgcctccaaccagcaggcggggtccgatggcggtcctccaaaggtgacccatgagcag
ttcaaggaggcactacagatggtggtggaccctggcgacccgaggatgactttggagaac
tttgtgaagattggagaggggtccacaggcgtggtttgcatcgcccgggaaaagtacagc
gggagacaggtggctgtgaagatgatggacctcaggaagcagcaacggcgagagctgctc
tttaatgaggtggtgatcatgagggactaccggcaccagaatgtggtggaaatgtaccgt
agcgctctagtggaggatgagctgtgggtcatcatggagtacctgcaaggtggcgctcta
acccacatcgtcagtgagaccaggttgaacgaggagcagatagcgacagtctgtgagggg
gtcttgcgggcgctgtcttacctgcactctcagggtgtgatccaccgagacatcaagagc
gactccatcctgctcaccctggacgggaagatcaaactgtccgactttggtttctgcgct
cagatcagcaaagaagtcccaaagagaaagtctctggtcgggaccccatactggatggct
cctgaggtgatcgccaaaatgccatatggcaccgaggtggacatctggtctctgggaatc
atggtggtggagatggttgatggagagccaccgtatttcagtgacacgcccatcactgca
atgaagaagctgcgagacgaagcagtgccaagcgtcaagaacgtccagcgggtgtctccc
gtgttgaaggacttcctgggctgcatgttgacccgtgacacgctgcagaggagcagcgcc
gccgacctgctggagcacccattcatgctgcaggccggctcaccacgctgcctcgttcct
ctggtggagcagtaccgcaaacgcatgtcactctgctga

KEGG   Maylandia zebra (zebra mbuna): 101465929
Entry
101465929         CDS       T02814                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101465929
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101465929
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101465929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101465929
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101465929
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE20 family
   101465929
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 101465929
NCBI-ProteinID: XP_004569690
UniProt: A0A3P9DEP4
LinkDB
Position
LG14
AA seq 660 aa
MFAKKKKSRIQISAPSNFEHRVHTDFDEQEQKFVGLPRQWQSLIEDTAQRPKPFIDATII
TTVEPRKTIVRGSRMGTESLTWLLDEFDTMSVTRSNSLRRGSPPTHPRRDSSSSGGGGGQ
ENGDPQHRHYSDRQDRDRLRQDQQSGGDPGHQGQRGVRPPQTDEVIQGRPQQQPRGQEPN
RAQRDRQGPPPPPHRDRRPRDRDQDHGAQRDQPGDHRPKSSYVARDSSPQSPRDKRPLSG
PNIRTPNLPMSEGVMKTAQQATRPFNTYPRTESDGGRSPTGQVGRHHESSPQNGPSSGSV
RGSSGSKPPISHPHPHHSSHPILAPESSQLPHTPHPNVPAPRPPVPSGPAASGAPPQGRS
PQREPQRVSHEQFRAALQMVVDPGDPRTYLDHYIKIGEGSTGIVCIATMKTTGKLVAVKK
MDLRKQQRRELLFNEVVIMRDYHHENVVEMYNSYLVGDELWVVMEFMEGGALTDIVTHTR
MNEEQIATVCLSVLKALSVLHTQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVQR
RKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNL
PPKLKNLHKVSPLLKSFLDRMLVRDPAQRATASELLKHPFLSKGGPPSCIVPLMRQNRMK
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgtttgccaaaaagaagaagtctcgtatccagatctcagctccgtccaactttgagcac
cgtgtgcacacggactttgacgagcaggagcagaagtttgtcgggctgccgcggcaatgg
cagtcactcatcgaagacacggcgcagaggcccaaaccctttatcgacgcgaccatcatc
actactgtagaaccgcgaaagaccatcgtacgcggcagcaggatgggaacagagtctcta
acatggctgctggatgagttcgacaccatgtccgtgactcgctccaactccctgcggcga
gggagtcctccaacacaccctcgcagggactcgagctcttcaggaggaggtggagggcag
gagaacggagatcctcaacacagacactactcagacagacaagacagagaccgactcaga
caagaccagcagagcggaggtgaccccggccaccaaggtcagcgcggagtccgtcctcct
cagacagatgaggtgatccagggccgcccccaacagcagccccggggtcaagagcccaac
agagcccagagggacagacaaggcccccctcctccccctcacagagacagacggcctcgg
gacagagaccaggatcatggggctcagcgggatcagcctggtgaccacaggccaaagtcc
agctatgtggcacgggacagcagtcctcagtctcccagagacaagaggcctctctcagga
cccaacatacgcaccccaaatctgccaatgtctgagggagtgatgaaaactgctcaacaa
gccactcggccgtttaacacatacccgcggacagagagcgatggcgggcgcagccccact
ggacaggtgggtcgacaccatgagtcctcacctcagaacggcccctctagcggctccgtc
cgaggttcctctggctccaaaccccctataagccacccacaccctcatcactcttcgcac
cccatcctggcccccgagtcctcccagctcccgcacacccctcaccccaacgttccagcc
ccacgaccccctgtaccctctgggcccgctgcatcgggtgctcctcctcagggccgctca
ccacagagggaaccccagagagtttcccatgagcagttcagggcggcactgcagatggtg
gtcgatccgggcgatccgcggacctacttggatcactacattaagatcggtgagggctcc
acagggattgtgtgtatcgctacgatgaaaaccacaggaaaactggtcgccgtgaagaag
atggacctgaggaaacaacagcgcagagaactcctcttcaacgaggtggtgatcatgcgg
gactatcaccatgagaacgtggtggagatgtataacagctacctggtgggggatgagctc
tgggtcgtcatggagttcatggagggaggagcgctcactgacatcgtgacacacacaagg
atgaatgaggagcagatcgccacagtgtgtctgtccgtcctgaaggcgttgtctgtcctt
cacacacagggtgtgatccatagagacataaagagcgactccatcctcctcactcatgac
ggacgggtgaagctgtccgactttggtttctgtgcacaggtgtctaaggaagttcagaga
aggaagtctctggttggaactccatactggatggcaccagagctcatatccagattacct
tacggaccagaggtggatatctggtctctgggtatcatggtcatagagatggtggatggg
gagccaccgtacttcaatgagccgccactcaaagccatgaaaatgattcgagacaacctg
ccacccaaactgaagaatctgcacaaggtctcccctctgctcaaaagcttcctggaccgg
atgttagtgcgagacccggctcagagggccaccgccagcgagcttctcaagcacccgttc
ctgtcgaagggggggccgccgtcctgcatcgtgcctttgatgcggcagaacaggatgaag
tga

KEGG   Maylandia zebra (zebra mbuna): 101473947
Entry
101473947         CDS       T02814                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 2 isoform X1
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101473947
   04012 ErbB signaling pathway
    101473947
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101473947
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101473947
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101473947
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101473947
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE20 family
   101473947
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo DUF3246 Rb_C Haspin_kinase
Other DBs
NCBI-GeneID: 101473947
NCBI-ProteinID: XP_012778452
UniProt: A0A3P9B1S0
LinkDB
Position
Unknown
AA seq 513 aa
MCDSGVCEDKPPAPPVRMSSQGGVKDAQSTNHNSRPLPSAPEEKKPRNKIISIFGEKAGK
KKDRDKDRPEISSPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNISKSEQKQNPQAV
LDVLKFFDSTSGKQKYLSFSGADKGSQSPGKQGTATSPSGKDDDDDDEADSPPPIVAPRP
EHTKSMYTKTVEPIPAPVGNATSKAADKQNNTPRKMTDDEIMEKLRTIVSIGDPKKKYTR
YDKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFVD
SFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKS
DNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGI
MAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFRSFLNLCLEMDVEKRGSG
RQLLQHPFLKVAKPLSSLTPLILAAKEAIRSNR
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgtgtgacagcggagtgtgtgaggataagccccccgccccccctgtcaggatgagcagc
caaggaggagtcaaagacgcccaatcgaccaatcacaactctcggccacttccgtctgca
ccagaggagaagaagcctagaaacaagatcatctccatctttggagagaaagcaggcaag
aaaaaggaccgggataaggacagacctgaaatctcctccccatcagactttgaacacacc
atccatgtgggttttgatgctgttactggagaattcacgggcatgccagagcagtgggcc
cgtctccttcaaacttccaacatcagtaaatcagaacagaaacaaaatcctcaggccgtc
cttgatgttctcaagttcttcgactccaccagtggaaaacagaaatacctcagtttttct
ggcgcggacaaaggatcacagtcgccaggcaagcagggtactgcaacctccccatcaggc
aaggatgacgacgacgacgatgaagctgattcgccgccaccaatcgtggcaccacggcca
gaacacacgaaatcaatgtacacgaagacagttgaaccaatcccagctccagttggaaat
gccacctctaaggcagctgacaagcagaacaatacgccaagaaagatgactgatgatgaa
atcatggaaaaactaagaacgattgtgagcattggagatcctaagaagaaatacactcgc
tatgacaagatcggtcagggagcgtctggcacagtttacacagccatcgatgttgccaca
gggcaagaggttgccatcaaacaaatcaacttgcagaagcagccaaagaaggagctaatt
atcaatgagatcctggtcatgaaggagctgaagaaccccaacattgtcaacttcgtagac
agtttccttgttggagacgagcttttcgtggtaatggaatacctggccggcgggtcgcta
accgatgttgtgacagagacctgtatggatgaagctcaaattgctgctgtctgcagagag
gtccttcaggccctggagtttctccatgcaaaccaggtcatccacagggacatcaagagt
gacaacgttctccttgggatggacggatcagtcaaactcactgacttcggtttctgtgct
cagattaccccagagcagagcaagcgcagcaccatggtgggtacaccctactggatggct
ccagaggtagtaacccggaaagcctatggacccaaagtggatatttggtctctggggatt
atggccatagagatggtggagggagagcctccatacctaaatgaaaatcctctcagggca
ttgtatttaatcgccaccaatgggacccctgagctacagaacccagagaagctgtctcct
gtgttcagatctttccttaacctttgtctggagatggacgtggagaaacgagggtcaggc
agacagctgctgcagcatccattcctgaaggtggcgaagcctctatccagcctcaccccg
ctcatcctggcagccaaggaagccatcaggagcaatcgctaa

KEGG   Maylandia zebra (zebra mbuna): 101475185
Entry
101475185         CDS       T02814                                 

Gene name
pak6
Definition
(RefSeq) serine/threonine-protein kinase PAK 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101475185 (pak6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101475185 (pak6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101475185 (pak6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101475185 (pak6)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101475185 (pak6)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE20 family
   101475185 (pak6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 101475185
NCBI-ProteinID: XP_004540867
UniProt: A0A3P9DPM9
LinkDB
Position
LG19
AA seq 697 aa
MFRKKKKKRPEISAPKNFEHRVHTSFDAKRGCFVGLPTQWQSLIENLRRPKPMVDPSRIT
EVELRPKKTIVRGSMIGHGDYIAAMINDMSRLSVTSSNSLRKSSPSARKRAQSLGRLGEV
NEGDTYQYEGLTQEDDDDEEDAGQEQWRNRARNIHSETNTPYLGMKKSITLQPNGILPKA
TSTYEVGVSSLEGPSHPAQSQNIQMPSHGAYMSSDMGSPQERVIWKRDFQLSRGMPPNQR
PVACFYSPAMTVQPPQGDQGTVTTELRPNIPIYMHQQNSPGRPFSSYDLKGESAVRYHSG
FLPTGTSSPLVGGVRPQRTVRSSASYTLGLSPNMGLRPSGPDPFLRHSGCPNPPYPRQDS
PSQPRPSPTGSLATSPPGTCSPAFRPPQHPSPRPPPDPPKVTHEQFKAALQMVVDKGDPR
SYLENFVKIGEGSTGVVCIATEKHSGRQVAVKMMDLRRQQRRELLFNEVVIMRDYQHRNV
VEMFKSALVEEELWVIMEYLQGGALTNIVSETRLSEEQIATVCEAVLQALAYLHSQGVIH
RDIKSDSILLTLDGRVKLSDFGFCAQISKDIPKRKSLVGTPYWMAPEVISKSPYGTEVDI
WSMGIMVVEMVDGEPPYFSETPVAAMKRLRDEPAPTVRNASQVSPVLKDFLDRMLTRDPL
ERASAIDLLEHPFLLQSGSPQCLVPLVEQYRKRMSRC
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgtttcgcaaaaagaaaaagaagaggcctgagatatcagcccccaagaattttgagcac
cgagttcacacctcttttgatgctaagcgcggctgctttgtgggcctgccgacacagtgg
caaagcctgatagagaacctgcgaaggcccaaacccatggtggacccttccaggatcaca
gaggtggagttgagaccaaagaagaccattgtgcgtgggagcatgatcggacacggagac
tacatcgcagccatgatcaatgacatgagccgtctgtctgtgaccagttccaactctttg
cggaagagcagcccttcagccaggaagagagcccagtctctgggaaggttgggggaagtg
aacgagggagacacttaccagtatgagggtctgacccaggaggatgatgacgatgaggag
gatgcgggccaggaacagtggaggaatagggccaggaacatccacagtgagaccaatacc
ccctacttgggcatgaagaagagtatcactctgcaacctaatgggattttgcccaaggcc
acgtccacctatgaagtcggggtcagctctctcgagggcccatcacatcctgctcagtcc
cagaacatccagatgccaagtcacggggcttatatgagtagtgatatgggtagtcctcag
gagagagtgatatggaagagagatttccagctgtcaaggggaatgccaccaaatcaaagg
cctgtagcttgtttctacagccctgctatgacggtacagccaccccagggagatcaaggc
acagtcaccacagaactccgacccaatataccaatatacatgcaccaacagaacagccct
ggcaggccgttctcctcctatgacctgaaaggagaatcagcagtgaggtaccactctggt
ttcctgcccaccggcaccagcagtcctcttgtgggaggcgtcagaccccagcggactgtt
cgctcctcagccagctacaccttgggtctgtctcctaatatgggactgagacccagtgga
ccagacccctttctcagacactccggatgccccaaccctccctatcccagacaagacagc
ccttcccaacctcgaccttcacctacaggctcattagccaccagtcctccaggcacctgc
tcccctgccttcagacccccgcaacacccctcacccagaccgccacccgacccacctaag
gtgacacatgaacagttcaaggcggccctgcagatggtggtggacaaaggcgatccccgc
tcttatctggagaactttgtgaagatcggagagggctccacaggagtggtgtgtatcgca
acagagaagcacagcggccggcaagtggcggtgaagatgatggacctgcggcggcagcag
aggcgagagctactctttaatgaggtggtcatcatgagggactatcagcacagaaatgtg
gtggagatgtttaagtctgctctggtggaggaagagctgtgggtcatcatggagtacttg
cagggtggagcactgactaacattgtttctgaaaccaggctgagtgaagagcagattgct
acagtgtgtgaagctgtgctgcaagccctggcttatctccattcacagggagtcattcac
agagacatcaaaagtgactctatactacttacgttagacggaagggtcaagctttcagac
tttggcttctgtgcacagatcagtaaggacatccctaagaggaagtctctagtggggaca
ccttattggatggcgcctgaggtcatatccaagtcgccatatggcactgaagtcgatata
tggtcgatgggcatcatggtggttgagatggtggatggagagccaccatacttcagtgaa
acccctgtagcagcgatgaagaggctgagggatgagccagctcctactgttcgaaacgcc
agtcaggtctctccagttcttaaagacttcctggaccgtatgctgactcgagacccccta
gagagagccagcgccatcgacttgttggagcaccccttcctgctgcagagcggctcacct
cagtgcctggtcccactggtggagcaataccgcaagcgcatgtcccgctgctga

KEGG   Maylandia zebra (zebra mbuna): 101482829
Entry
101482829         CDS       T02814                                 

Gene name
pak2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101482829 (pak2)
   04012 ErbB signaling pathway
    101482829 (pak2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101482829 (pak2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101482829 (pak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101482829 (pak2)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101482829 (pak2)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE20 family
   101482829 (pak2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 101482829
NCBI-ProteinID: XP_004557239
UniProt: A0A3P9CX95
LinkDB
Position
LG23
AA seq 529 aa
MCDNGDPEDKPPAPPVRMSSTIFSTGSGKDSLSANHSSKPLPSVPEERKRNKIISIFSGA
EKSGRKKDRDKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKK
NPQAVLDVLKFYDSTGNGRQKYLSFSSSEKDTFTVGPQSAAKKGTEPSSPNIKDIDDDDD
DEAPPPVVAPRPEHTKSVYTRSVIDPIPAPSTCPDGDVASKAADRQKRKGKMSDEEIMDK
LRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVSTGQEVAIKQINLQKQPKKELIINEI
LVMKELKNPNIVNFLDSFLMGEELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQA
LDFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVV
TRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRD
FLNLCLEMDVEKRGSGKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgtgtgataacggagatcctgaggataaaccccctgcccctccggtcaggatgagcagc
actatcttcagcactggctctggcaaagactcactttcggccaaccacagctctaaaccg
ctgccttctgtgcctgaggagaggaagcgcaataagatcatctcaatcttctctggggct
gaaaaaagtggtaggaagaaagatcgagacaaagagcgaccagaaatctcaccgccttca
gattttgaacataccatacatgttgggtttgacgctgtaacaggggagttcacgggtatg
ccagagcaatgggctcgactactccagacgtcaaacattaccaagtcagagcagaagaaa
aacccacaggctgtgcttgatgtccttaagttctatgactctacagggaacggtcgtcag
aagtacctcagcttctcatcctctgaaaaagacacattcacagtagggcctcagtctgct
gccaaaaaaggcactgaaccctcatctccaaacatcaaagacatagatgatgatgacgat
gatgaagcgcctccaccagttgtggcaccaagaccagaacacacaaagagtgtatatact
cgctctgtcatcgaccccatccctgctccaagcacgtgtccggacggagatgtggcctcc
aaggctgcagacaggcaaaaaaggaagggcaagatgtcagacgaagagatcatggacaaa
ctgagaaccatagtcagtattggggatcccaagaagaagtacacccgatatgaaaagatt
ggccagggggcatcaggaacagtattcacagccattgatgtatccacaggacaggaggtc
gccattaaacagatcaacttacaaaagcagccgaagaaggagctgatcatcaacgagatt
ctagtgatgaaggagctcaagaacccaaacattgtcaactttttagacagtttcctgatg
ggggaggagttatttgtggtgatggaatatcttgctggtggctcgctgacagatgtggtt
acagagacctgcatggatgaggcccagatagctgctgtctgccgagagtgtttacaagca
ttggatttcctacacgcaaatcaggtcatccacagagacatcaaaagtgacaatgtgctg
cttgggatggatggttctgtcaagctgaccgattttggcttttgcgcccagatcactcca
gagcagagcaaacgcagcaccatggtaggcacgccttactggatggctcctgaagtggtg
accagaaaggcttatgggcctaaagtagatatttggtcactgggtattatggccattgag
atggttgaaggagaacctccctacctgaatgagaatccactacgagcattatacctaatt
gctacaaatggcacacctgagcttcagaatcctgagaagctgtctccaattttcagagat
tttctaaacctgtgcctggaaatggatgtagagaaaagaggcagtggcaaagagctcctg
cagcatccatttttgaagctggcgaaacccctctccagtctcacacctctcatcttggca
gccaaggaggccatgaagagcaatcgttag

KEGG   Maylandia zebra (zebra mbuna): 101483196
Entry
101483196         CDS       T02814                                 

Gene name
pak1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1 isoform X1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101483196 (pak1)
   04012 ErbB signaling pathway
    101483196 (pak1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101483196 (pak1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101483196 (pak1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101483196 (pak1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101483196 (pak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101483196 (pak1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101483196 (pak1)
   03036 Chromosome and associated proteins [BR:mze03036]
    101483196 (pak1)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101483196 (pak1)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE20 family
   101483196 (pak1)
Membrane trafficking [BR:mze04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101483196 (pak1)
 Endocytosis
  Macropinocytosis
   Kinases
    101483196 (pak1)
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101483196 (pak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 101483196
NCBI-ProteinID: XP_004575564
UniProt: A0A3P9DFJ3
LinkDB
Position
LG14
AA seq 583 aa
MSDNGEVEDKPPAPPMRNTSTMIGSCNKDPVPLNHGSKPLPPNPEDKKKKDRSIRFILTG
GGDKTYKRKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSKETTNSQKYMSFTDKTADAFSSSTTTLGHQPSVRLSARDREEERDRKS
SKAVSETPAIATVSEDEDEDEAEPPPVIAPRPEHTKSIYTRSVIEPLPPPPTKDAATSPI
SPPTAAAAAVTPAQPAEAAPSSPPSASPAPGPSLPHPQDKARKKKMSDEEILEKLRTIVS
VGDPKKKYTRFEKIGQGASGTVYTAIDVATGQEVAIKQMNLQQQPKKELIINEILVMREN
KNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHS
NQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYG
PKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSTIFRDFLNRCL
EMDVEKRGSAKELLQHQFLKMAKPLSSLTPLILAAKEAAKNNR
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgtctgataatggggaggtcgaggacaagcccccagctccgcccatgaggaacaccagc
accatgattggctcctgcaacaaggaccccgtccccctcaaccatggctccaagcccctc
cctccaaacccggaggacaagaagaagaaagaccgctccattcgattcatcctgacagga
ggaggcgataaaacctataagaggaaggagcgcccagagatctctctgccgtcagacttc
gaacacaccatccatgtcggctttgatgctgttaccggggagttcactgggatgccggag
cagtgggctcggcttctgcagacatccaacatcaccaagctggagcagaagaagaaccct
caggccgtcctcgatgttttaaagttctacgactcgaaagaaacgaccaacagccagaag
tacatgagcttcactgataaaactgctgacgccttcagctcctccaccacaacgcttggc
caccagccgagcgtcagactatcagcgagagacagagaggaagagagggatagaaagagc
tccaaggccgtgtccgagacacccgccatagcaaccgtatctgaggatgaggacgaagac
gaggccgagcccccgccggtgatcgccccccgaccggagcacaccaaatcaatttacact
cgctcagtgatcgagcccctccctcctcctcccacgaaagatgctgcgacctcacccatc
tctccaccgaccgccgcggccgccgccgtcacccccgcccaacctgcagaagcagctccc
agcagccctcccagtgctagccccgcccctggtccttccttgccccacccacaggacaaa
gccaggaagaagaagatgtctgacgaggagatcctggagaagctacggacgatcgtcagt
gtgggcgaccccaagaagaaatatacacgatttgagaagatcggacagggggcgtctggg
acggtgtacacagctatcgacgtcgccacaggacaggaggttgccatcaaacagatgaac
ctgcagcagcagccgaaaaaggagctgatcatcaacgagattctggtgatgagggaaaac
aagaacccaaacatagtcaactacctggacagttacctggtgggtgatgagctctgggtg
gtgatggagtacctggccggaggctcgctgactgatgtcgtaacagaaacgtgcatggat
gaagcccagattgctgctgtgtgcagagagtgtctccaggcgttggagttcctgcactca
aaccaggtcatccatcgagacatcaagagcgacaacatcctgctgggcatggacggctcc
gtcaagctcactgacttcggattctgcgctcagatcactcctgagcagagtaagcgcagc
accatggtcggcacgccgtactggatggctccggaggtcgtgacccgtaaagcttacggt
cccaaagtggacatctggtctctgggcatcatggcgatagagatggtggagggagagccg
ccgtacctgaacgagaatccgctcagggcgctgtatctcatagcaaccaacgggacgccg
gagctgcagaacccggagaagctgtcgacgatattcagagacttcctgaaccgatgtctg
gaaatggacgtggagaagagaggctcggctaaagagctgctgcagcatcagtttctgaag
atggcgaagccgctctccagtctgactcctctcattctggcggcgaaggaggcggccaag
aacaaccgctag

KEGG   Maylandia zebra (zebra mbuna): 101484450
Entry
101484450         CDS       T02814                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 3 isoform X1
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04810  Regulation of actin cytoskeleton
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101484450
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101484450
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101484450
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101484450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101484450
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101484450
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE20 family
   101484450
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal DSHCT PTPRCAP DUF2052 APH Kdo CDC45 RXT2_N Astro_capsid_p
Other DBs
NCBI-GeneID: 101484450
NCBI-ProteinID: XP_004564027
UniProt: A0A3P9CJT7
LinkDB
Position
LG10
AA seq 575 aa
MSDSVDIEEKPPAPPLRMNSSSRDSSSVNHASKPLPMAPEEKNKKVRLRSIFPGGDKTNK
KKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLD
VLKFYDSKETVNNQKYMSFTSGDKSAHGYIAANTLNRLLSSGPPVSLRTCSALFDKGAKT
STTEPPIAPPVSEEEDEEEEEEEEEEDEEDDDDELPPVIAPRPEHTKSIYTRSVMDPPKP
PTPVKEVLTPPESQVQPENTPNTMYRHTDRQKKKSKMTDEEILERLRSIVSVGDPKKKYT
RFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNSNIVNYL
DSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIK
SDNILLGMDGSVKLTDFGFCAQITPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLG
IMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSSVFRDFLNRCLEMDVDRRGS
AKELLQHSFLKLAKPLSSLTPLIVAAKEAIKNSSR
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgtctgatagtgttgatattgaagagaaaccaccagccccccccttgagaatgaacagt
agttcccgagactcttcatcagtgaatcacgcatccaaaccgcttccaatggctcctgaa
gagaaaaacaagaaggtccgcctgcgttccatcttccccgggggagacaagacaaacaag
aagaaagagaaggaacgtcctgagatatccctaccctcagacttcgaacacaccattcat
gttggctttgatgctgtaacaggagaattcacaggcatcccagagcagtgggcacggctc
ttacagacctcgaacatcaccaagctggagcagaagaagaacccgcaggccgtgttggac
gtcttgaagttttatgactccaaagagaccgtcaacaaccagaagtacatgagcttcact
tcaggagacaagtcagcacatgggtacatagcagcaaacactctgaaccggctgctgtca
tctgggcctcctgtcagccttagaacctgcagcgcattatttgacaagggtgccaaaaca
tcaacaacagaacccccgattgctccgcctgtgtcagaggaggaggatgaggaggaagag
gaggaggaagaagaagaagacgaagaggacgacgacgatgaactgcccccagtcattgcc
cctcgaccggaacacaccaaatctatctatacgcgctccgtcatggatccaccaaagcct
cccacccccgtgaaagaggtgctgactccaccggagtcacaggtccagccggagaacacg
cccaacacaatgtatcgccataccgaccggcagaagaaaaagtccaaaatgacggacgag
gagattctggagagactcaggagtattgtgagtgtgggggatcccaaaaagaagtacaca
cgcttcgagaaaataggacaaggagcgtccgggactgtgtacactgccatcgatatagca
accggccaagaggtggccattaagcagatgaacttgcagcagcagcccaagaaagagttg
atcatcaatgagatcttggtgatgagggaaaacaaaaactccaacatagtgaactacctt
gacagttacctggtaggagatgagctttgggtggtgatggagtatttggctggaggctcg
ctgacagatgtagtgactgagacctgcatggacgaaggccagattgcagcagtctgcaga
gagtgtctgcaagctttggactttctacactccaatcaagttatccatagagatataaaa
agtgacaacatcctcttagggatggatggatctgtgaagctgaccgacttcggcttctgc
gctcagatcactcccgagcaaaacaagcgcagcacgatggtgggaacgccctactggatg
gcaccagaggtggtgactcggaaagcgtacggcccgaaagtggacatctggtctctggga
atcatggcgatagagatggtggaaggagaaccaccttatctgaatgagaatccactcagg
gcgctctacctgatcgcaaccaacgggactccagagctgcagaatccagagagactatca
tctgtgttcagagacttcctcaaccgctgtctggagatggatgtggaccgcagaggttct
gccaaggagttgctccagcattctttcctcaagttggcgaagcctctatccagcctgacg
cccctgattgtagctgcaaaggaagccataaagaacagcagtcgctaa

DBGET integrated database retrieval system