KEGG   Maylandia zebra (zebra mbuna): 101463670
Entry
101463670         CDS       T02814                                 

Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04137  Mitophagy - animal
mze04210  Apoptosis
mze04310  Wnt signaling pathway
mze04510  Focal adhesion
mze04530  Tight junction
mze04620  Toll-like receptor signaling pathway
mze04621  NOD-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04912  GnRH signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101463670
   04012 ErbB signaling pathway
    101463670
   04310 Wnt signaling pathway
    101463670
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101463670
  09143 Cell growth and death
   04210 Apoptosis
    101463670
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101463670
   04530 Tight junction
    101463670
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101463670
   04621 NOD-like receptor signaling pathway
    101463670
   04625 C-type lectin receptor signaling pathway
    101463670
  09152 Endocrine system
   04912 GnRH signaling pathway
    101463670
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101463670
Transcription factors [BR:mze03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    101463670
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 PspA_IM30 ZapB DUF4407 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 101463670
NCBI-ProteinID: XP_004561963
LinkDB
Position
LG7
AA seq 347 aa
MTAKMETPFYHDDSPAVPGFSQIAEYERYSGNKMLMSKKAMSMAGSHHFPSGGGAGGRGG
NPNILGLASNSSLMTSAASSAASSADMNLLKLASPDLEHLIIQSNQGLVTTSPVPNSTNP
FMYRNQATNEQEGFADGFVKALADLHKQNQLVGGGPMSPPSSSSVSLQASYQRNLMSGGD
MPIYTNLSSYNPGQMPYSGGQMAYGGGSGHGGGGAPQPHPRGLDAPQTVPEVPHPAGDPT
SPPSLSPIDLETQERIKAERKKLRNRIAASKCRKRKLERISRLEEKVKVLKSQNSDLAST
AAMLREQVAQLKQKVMSHVTNGCQISVSSSAASKAGGGGTGSEDSSC
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgacggccaagatggagactcctttctaccacgatgactcccccgctgtgcccggcttc
agccagatcgccgaatacgagcgctactcgggaaacaagatgctgatgagtaagaaagcc
atgtcaatggcaggaagtcaccacttccccagtggtggtggagcaggagggaggggtggg
aaccccaacatcctggggctggctagcaacagctccttgatgacatcagcagcgtcctct
gcagcatcctcagcagacatgaacctgctaaagctggcgtccccagatctggagcacctg
atcattcagtccaaccaggggctggtcaccaccagcccggtgccaaactccaccaatccc
ttcatgtaccgcaaccaggccaccaacgagcaagaaggatttgctgatggctttgtcaag
gcgctggcagaccttcacaagcagaaccagctggttggaggtgggcccatgtctccgcct
tcatcctctagtgtctccctgcaggcgtcctaccagaggaatctgatgtcaggcggagat
atgcccatctacaccaacctgagcagctacaacccgggccagatgccatactctggaggg
cagatggcatatggtggaggctcaggccacggtggaggtggagcacctcagccacaccct
cgaggcctggatgccccgcagactgtccctgaggtccctcatcctgcaggggaccccacc
tcgccaccgtcgctctcgccaatcgacctggagacacaggagcgaatcaaagcagaacgc
aagaaacttcgcaaccggattgccgcatctaaatgtcgcaagcggaagctggagcgcatc
tcacggctggaggagaaggtgaaagtcctgaagagccagaactcggacctggcctccacc
gccgctatgctacgggaacaggtcgctcagctgaaacagaaggtcatgagtcacgtcaca
aatggctgccagatttcggtaagctcatcagctgccagcaaggccggaggaggaggcacc
ggcagcgaggactccagctgctga

KEGG   Maylandia zebra (zebra mbuna): 101472459
Entry
101472459         CDS       T02814                                 

Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04137  Mitophagy - animal
mze04210  Apoptosis
mze04310  Wnt signaling pathway
mze04510  Focal adhesion
mze04530  Tight junction
mze04620  Toll-like receptor signaling pathway
mze04621  NOD-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04912  GnRH signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101472459
   04012 ErbB signaling pathway
    101472459
   04310 Wnt signaling pathway
    101472459
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101472459
  09143 Cell growth and death
   04210 Apoptosis
    101472459
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101472459
   04530 Tight junction
    101472459
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101472459
   04621 NOD-like receptor signaling pathway
    101472459
   04625 C-type lectin receptor signaling pathway
    101472459
  09152 Endocrine system
   04912 GnRH signaling pathway
    101472459
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101472459
Transcription factors [BR:mze03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    101472459
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 ZapB PspA_IM30 FlaC_arch NBP1 Paralemmin Jnk-SapK_ap_N Fib_alpha DUF3450 Seryl_tRNA_N TEX13
Other DBs
NCBI-GeneID: 101472459
NCBI-ProteinID: XP_004557290
LinkDB
Position
LG23
AA seq 327 aa
MYTKMETTFYDDSLNAFSQHDNAGYGYSNPKALKHNMTLNLTDPPSALKPHLRAKAGDIL
TSPDVGLLKLASPELERLIIQSSNGLITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAEL
HHQNMPGTTNVSVTSTPPATVNTALPPVSSVAGATVYNNNAAMRSESPVYEDLNTFNPAI
STVSAPNYTTSAPTMSFSAAPPQLPIYGQPSPAQLPRLTALKEEPQTVPEMPGETPPLSP
IDMESQERIKAERKRMRNRIAASKCRKRKLERISRLEEKVKTLKSQNSELASTANMLREQ
VAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtataccaagatggaaactactttctatgacgactcactcaacgctttctcccagcac
gacaacgccggctacggatacagcaaccccaaagcgctgaaacacaacatgacactgaac
ctcaccgacccgccgagcgctctgaaacctcacctccgcgccaaagctggcgacatcctc
acctcccccgacgtgggtttgctgaagctggcctctccggagctggagaggctgatcatc
cagtccagcaacggactcatcaccaccacgccgaccccgacccagttcctgtgccccaag
aatgtcactgacgagcaggagggcttcgcggaggggtttgtgcgcgccctggctgagctc
caccaccagaacatgccgggcacaacaaacgtgagtgtcacctcgactccaccggcaact
gtcaacactgcgctgccgcctgtttcatctgttgccggtgccaccgtatacaacaacaat
gctgccatgcgctctgagtcgccggtttatgaggacttgaacactttcaacccggccatc
agtaccgtgtcggcaccaaactacaccacctcagcccccactatgtccttctctgctgcc
ccgcctcagcttcccatctacggccagccttcccctgcccagctcccccggctcactgcg
ctcaaagaggagccccaaaccgtgcccgagatgccaggggagacccctcctctttctcca
atcgatatggagagtcaggagcgcatcaaggctgagagaaagcggatgagaaaccgcatc
gctgcctccaaatgccggaagaggaagctggagcggatctcaaggctggaggagaaagtg
aagaccctaaagtcacagaactccgagctcgcatccaccgccaacatgttgcgcgagcag
gtggcccagctgaagcagaaggtgatgaaccacgtaaacagcgggtgccagcttatgtta
acgcagcagctccagaccttctga

KEGG   Maylandia zebra (zebra mbuna): 101486839
Entry
101486839         CDS       T02814                                 

Gene name
jun
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04137  Mitophagy - animal
mze04210  Apoptosis
mze04310  Wnt signaling pathway
mze04510  Focal adhesion
mze04530  Tight junction
mze04620  Toll-like receptor signaling pathway
mze04621  NOD-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04912  GnRH signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101486839 (jun)
   04012 ErbB signaling pathway
    101486839 (jun)
   04310 Wnt signaling pathway
    101486839 (jun)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101486839 (jun)
  09143 Cell growth and death
   04210 Apoptosis
    101486839 (jun)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101486839 (jun)
   04530 Tight junction
    101486839 (jun)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101486839 (jun)
   04621 NOD-like receptor signaling pathway
    101486839 (jun)
   04625 C-type lectin receptor signaling pathway
    101486839 (jun)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101486839 (jun)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101486839 (jun)
Transcription factors [BR:mze03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    101486839 (jun)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 NBP1 Phlebovirus_NSM ZapB
Other DBs
NCBI-GeneID: 101486839
NCBI-ProteinID: XP_004567226
UniProt: A0A3P9BQJ8
LinkDB
Position
LG18
AA seq 323 aa
MSRKMEATFYDEASNSQRDGAAVYGFNPKTLKQTMTLNLNDPKNFKPHLGAKALDILTSP
DVGLLKLASPELERLIIQSCNGLTTPTPTQFICSKNITDEQEGFAEGFVRALAELHYQQQ
IPAAQPDPQTGSANGMTSGSAAPESGGISYSCTVRTEPPEYTNLSSFTRAVIGSTPAPAG
ERQPPPPTSYPAAPQPSHNHMDHQLPVAAQHSRLHALKEEPQTVPEMSGETPPLSPIDME
SQERIKAERKRMRNRVAASKCRKRKLERIARLEDRVKNLKSQNTELVSSANVLRDELALL
KQKVMDHVNSGCQLILTQQLQAY
NT seq 972 nt   +upstreamnt  +downstreamnt
atgtccagaaaaatggaagcgaccttctacgacgaagcctccaactctcagcgggacggg
gcggcagtgtacggcttcaaccctaaaaccctcaaacagaccatgaccctgaatctgaac
gacccgaagaactttaaacctcatttgggcgccaaggccctggacatcctgacgtcccct
gatgtcgggttactgaagctggcctcacctgaactggagagactgatcatccagtcttgc
aacgggctgacaactcccaccccgacccagttcatctgctccaagaacattaccgacgag
caggagggcttcgctgaagggtttgtgagggcgctggctgagctccactaccagcagcag
atacctgccgcccagcccgacccacagaccggctcggccaacggcatgacatccggctcc
gctgcgcccgagagcggcgggatttcctacagctgcacggtgcgcacggagccgccggag
tacaccaacttgagcagcttcactcgggctgtaataggctccacgcccgcacctgccggc
gagagacagccacctccacctacaagttacccggcggccccacagccgtcccacaaccac
atggaccaccagctgccggtggctgcgcagcactcacggctacacgcgctcaaagaggag
ccacagacggtcccggagatgtccggcgagaccccaccgctctcccccatcgacatggag
tcccaagagcgcatcaaagctgaaagaaagcgcatgaggaacagggtggccgcgtccaaa
tgccggaaaaggaagctggagaggatcgcccgactggaggacagggtcaaaaacctaaag
agccaaaacacggagttggtttcctctgccaacgtcctgcgggacgagctggctctgctc
aaacaaaaggtgatggaccacgttaacagcggctgccagctcattttgacgcagcagctc
caagcttactag

DBGET integrated database retrieval system