KEGG   Maylandia zebra (zebra mbuna): 101463777
Entry
101463777         CDS       T02814                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101463777
   04370 VEGF signaling pathway
    101463777
   04068 FoxO signaling pathway
    101463777
   04070 Phosphatidylinositol signaling system
    101463777
   04150 mTOR signaling pathway
    101463777
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101463777
  09143 Cell growth and death
   04210 Apoptosis
    101463777
   04218 Cellular senescence
    101463777
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101463777
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101463777
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101463777
   04625 C-type lectin receptor signaling pathway
    101463777
  09152 Endocrine system
   04910 Insulin signaling pathway
    101463777
   04914 Progesterone-mediated oocyte maturation
    101463777
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101463777
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101463777
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101463777
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Ribosomal_L22e FadA ATG11 IL22 YihI
Other DBs
NCBI-GeneID: 101463777
NCBI-ProteinID: XP_004564872
LinkDB
Position
LG15
AA seq 549 aa
MADQNLQHSTEDDNLQPADYPTSSLASLHLRDEAVVTNENTNQIEDNPETGSVCPVVMSS
MFNQSRQQGDISMAIMPESHPADQEFLESEMGQSESEAQSDTLAAFLQDLSSHDHNDGTS
LPGKTNSSKEGEIYPENKIYKAMAECDCGADDHQLFEAEWYWGNISREEVNEMMRNTPDG
TFLVRDASSRIKGEYTLTLRKDASNRLIKIFHNGGKYGFSEPLAFSSVADLIQYYQKKSL
AQYNSKLDTRLLYPISRNQQQQVVMEADIDAAGEQLRIFQDQYKEKSKEYDRLFEELNLT
SQELQSKRTAIEAFSEIIRIFEEECETQERYSKEYIDMFLTLDSSTESEKIQNNSDELQS
RVEEIHSSKKKLEEELRNKALVHMEVDRKMNKLKPDLVELRKLRDQYLVWLTQQGTRQSQ
INDWLGIRSEEEDPYTLADDTHQEERSWYVGAMRRKEAEELLRGKRDGTFLIRDSQTRRG
SFACSVVVDGEVKHCVIYRTSTGYGFAEPYNLYSSLRELVLHYRHTSLIQHNQQLNVTLA
WPALSQQPS
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggcagatcagaatttacagcacagcacagaggacgacaaccttcagccagctgattac
ccaacgtcatcactagcatcgctacatctcagggatgaggctgtcgtcacaaatgagaac
accaaccaaatcgaggataatcctgagaccggttcagtatgtcctgtggtgatgtcatca
atgtttaaccaatcacgacagcagggagacatatccatggctatcatgcctgagtctcac
ccagcagatcaagagttcttggaaagtgaaatgggccaaagtgaaagtgaggcgcagtcc
gacaccctggcagcgttcttgcaggacctttcctctcatgatcataatgatggtacgtct
cttccaggaaaaaccaacagcagcaaggaaggagaaatatatccagagaacaaaatatac
aaagctatggcagaatgtgactgcggcgctgatgaccaccagctttttgaagcagagtgg
tactggggcaacatctcaagagaggaagtaaacgagatgatgagaaacactcctgatggt
acattcctggttcgagatgcttccagtaggattaaaggagaatacacgctgacattaaga
aaagacgcttcaaacagactaattaaaatcttccataatggcggcaagtacggcttctct
gagccactggctttttcctctgtagcggatctgatccagtattaccagaagaagtcactg
gcccagtacaactctaaactggatacacggttactctatccaatatccagaaaccagcag
cagcaggttgtgatggaagctgacattgatgcagctggagaacagctaaggatatttcag
gatcaatacaaagaaaaaagcaaagagtatgaccgcctattcgaggagctgaatctgacc
tcccaggaactgcagagcaagcgaactgccattgaagctttcagcgaaatcattcggatc
tttgaggaggaatgtgaaacccaagagcgctacagcaaggaatacatcgacatgttcctc
acattagacagcagtacagaatccgagaaaattcaaaacaattcagatgaactacagtcg
agggtggaagagatccacagcagcaagaagaagttagaggaggaactgaggaacaaggca
ctggttcacatggaggtcgacaggaaaatgaacaaactgaagcctgaccttgtggagctc
cggaagctcagagatcaatacctggtttggctaactcaacaaggcaccaggcagagccag
ataaatgactggctcggtattaggagtgaagaagaagacccatacaccctagcagatgat
acccaccaggaggagaggagctggtacgttggtgctatgagacgaaaggaggcggaggag
ctgctgagagggaagagagatgggacattcttaatcagagacagccagactcggagaggc
tcctttgcctgctctgtcgttgtggacggggaagtgaaacactgtgtaatttacaggacg
tccacgggatacggcttcgctgagccctacaacctgtactcatcactgagagagctcgtc
cttcactaccgtcacacatccttgatccagcacaaccagcagctgaatgtaaccctggcc
tggcccgctctcagccagcagcccagctga

KEGG   Maylandia zebra (zebra mbuna): 101464472
Entry
101464472         CDS       T02814                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101464472
   04370 VEGF signaling pathway
    101464472
   04068 FoxO signaling pathway
    101464472
   04070 Phosphatidylinositol signaling system
    101464472
   04150 mTOR signaling pathway
    101464472
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101464472
  09143 Cell growth and death
   04210 Apoptosis
    101464472
   04218 Cellular senescence
    101464472
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101464472
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101464472
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101464472
   04625 C-type lectin receptor signaling pathway
    101464472
  09152 Endocrine system
   04910 Insulin signaling pathway
    101464472
   04914 Progesterone-mediated oocyte maturation
    101464472
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101464472
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101464472
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101464472
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 DUF5638 OB_RNB Mod_r CC2-LZ PI_PP_I Bap31_Bap29_C
Other DBs
NCBI-GeneID: 101464472
NCBI-ProteinID: XP_004569417
LinkDB
Position
LG17
AA seq 442 aa
MEMQAAPALPPKPTKPQQPSSVAMAGGSSNVAKDGGAGGSLQEAEWYWGDISREEVNDKL
RDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFSSVVELISH
YRHESLAQYNTKLDVKLMYPISRFQQDQLVKEDNIDAVGKKLQEYHNQYQEKSKEYDRLY
EEYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQERYSKDYIERFRRESNDKEIERIMMN
YEKLKSRLGEIHDSKVRLEQDLKTQAMDNRETDKKMNSLKPDLIQLRKIRDQYLVWLNHK
GVRQKRINDWLGIKNENTDEGYFVSEEDENLPHYDEKNWFVGDLNRTQAEELLLGKPDGA
FLIRESSKKGCYACSVVVEGEVKHCVIYSTPRGFGFAEPYNLYSSLKDLVLHYHQTSLVQ
HNDSLNVRLAYPVYAQMPSGRR
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggagatgcaagcagcaccagcccttcctccaaagccaaccaagcctcagcagccctcc
tcggtcgcaatggcagggggcagcagcaatgtcgccaaggatggaggagcgggaggctcc
ttacaagaggccgaatggtactggggtgacatatccagggaggaggtgaatgataagctc
agagacatgcctgatgggactttcctggttcgggacgcatctactaagatgcaaggcgac
tacacgctaacgctaaggaaagggggcaataacaagctgataaagatctaccacagagat
gggaagtacggcttctctgaccccctgactttcagctcagtggtggagctcatcagccat
tacagacatgagtcactggctcaatacaacaccaagctagatgtcaagctcatgtacccc
atctcccgcttccagcaggaccagctggtgaaggaggacaacatcgatgcagtggggaag
aagttgcaggaataccacaatcagtaccaggagaaaagcaaagaatatgacagactatat
gaagagtataccaagacatcacaggagatccagatgaagcgaacagctattgaagccttc
aatgaaaccatcaagattttcgaggagcaatgccacacgcaggagcgctacagcaaggac
tacattgagcgttttaggcgtgagagcaatgataaagagattgagcgcatcatgatgaac
tatgaaaagcttaaatctcgcctcggagagatccacgacagcaaggtgcggctggagcag
gacctaaagacgcaagccatggacaaccgggagacagacaaaaagatgaacagcctaaag
cctgatctcatacagctccgcaaaatcagggatcagtatctagtctggctcaatcataaa
ggagttcgtcagaaacgaattaatgattggctgggaatcaagaatgagaacacagatgaa
ggttactttgtgagtgaggaagatgagaacttgcctcactatgatgagaagaactggttt
gtgggggatctgaacaggacacaggcagaggagctgctcctggggaagccagatggagct
tttcttatccgagaaagcagcaaaaaagggtgctatgcctgctctgtagttgtggaaggg
gaggtgaagcactgtgtcatctacagtacaccacgtggctttggctttgctgagccatac
aacctctacagcagcctgaaggacctggtgctccactaccaccagacttccctggtgcag
cacaatgactcactcaatgtgcgcctcgcctaccctgtctacgcacagatgccctctgga
cgaagatga

KEGG   Maylandia zebra (zebra mbuna): 101466374
Entry
101466374         CDS       T02814                                 

Gene name
pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00562  Inositol phosphate metabolism
mze01100  Metabolic pathways
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze05132  Salmonella infection
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101466374 (pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101466374 (pik3cb)
   04370 VEGF signaling pathway
    101466374 (pik3cb)
   04068 FoxO signaling pathway
    101466374 (pik3cb)
   04070 Phosphatidylinositol signaling system
    101466374 (pik3cb)
   04150 mTOR signaling pathway
    101466374 (pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101466374 (pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    101466374 (pik3cb)
   04218 Cellular senescence
    101466374 (pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101466374 (pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101466374 (pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101466374 (pik3cb)
   04625 C-type lectin receptor signaling pathway
    101466374 (pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101466374 (pik3cb)
   04914 Progesterone-mediated oocyte maturation
    101466374 (pik3cb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101466374 (pik3cb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101466374 (pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101466374 (pik3cb)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101466374 (pik3cb)
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101466374 (pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 RWD DUF4135
Other DBs
NCBI-GeneID: 101466374
NCBI-ProteinID: XP_004562856
UniProt: A0A3P9DRK9
LinkDB
Position
Unknown
AA seq 1078 aa
MPPAMTDLLDIWAAHSPLAGHAPDQITVDFLLPTGIYIQMDVPREATIQHIKLLLWKQAQ
SFPLFPALGEMESHMFECVNQAAVHEELEDETRRLCDVRPFLPVLKLVMRNCGRAERLLD
SKIGVLIGKGLHELDALNDQEVKDFRSKMFRISEERMQQIQMMAFSEWVQACYSPQLEPA
AVTAITAGVNDAPVDLKVIIHFDQSQDSASLKVSLSCTPNELMEQALKKWLTTHGSEDAV
WRGQYILRVSQCLEFLGGDHPLIQYKYIRSCLQAKEAPHLTLVHTSTVKTMFDKEISAIG
AVVSRKSSNPPLPLPPKRRPPTQVQTCVWDVPKPFRIVLVKGSKVNAEETAKVQVRAGLF
HGTELLCKPAVSNESSGRSEHTWKDNTVEFEISVCDLPRMTRLCFAIYAVMDKVKKQKST
KNPHINKYQTIRKAGKVHYPIAWVNTMVFDYKGQLKTGDIILHCWSSFPDELEEMLNPIG
TIQTNPYTENATALHIHFPEYSSHPIVFPPFDKILEKAAEMVSADCVSIGRGVKKFYMEL
KEIMERDPVSQLCENEKDLIWTLRQDCRETFPQSLPKLLLSVKWSKHEDMAQLQALLQIW
PKLSPRDALELLDFNYPDQYVREYAVRCLKDMSDEELSQYLLQLVQVLRYEPYYDCALTH
FLLERAQRNRQIGHFLFWHLRSEIHMPAVSVQFALLLEAYCRSNIPHIEVLKKQVEALSK
LKSVNELIKLGTIKNTRSKTKEAMLTKEAMMTCLRQSGYSETLSDLHSPLNPSVLLSDIN
VEKCRYMDSKMKPLWIVYNNKLLSGDTLGIIFKNGDDLRQDMLTLQILRLMDLLWKEAHL
DLRIVPYGCLATGDRTGLIEVVSSAETIANIQLTSSNVAAAAAFNKDALLNWLKERNSGD
ALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRSNGQLFHIDFGHILGNFKSKFGIK
RERVPFILTHDFIHVIQQGKTGNTEKFGSFRQYCEEAYLILRKNGNLFITLFALMLTAGL
PELTSVKDIQYLKDSLALGKTDEEALKQFRQKFDEALRESWTTKVNWMAHNVAKDNRS
NT seq 3237 nt   +upstreamnt  +downstreamnt
atgcctcccgccatgacagacctcctggacatatgggcggcacactcacctctggccgga
cacgctccggaccagatcactgtggactttttgcttcccactggtatttatatccagatg
gacgttccacgcgaggctacaattcagcacatcaaactgctcttatggaagcaggctcag
agcttcccactgtttcctgcactcggcgaaatggagagccacatgttcgagtgtgtcaac
caggcagccgtacacgaagagctggaggacgaaacgcgtcggttgtgcgacgttcgcccc
ttcctgcccgttctcaagctggtgatgcgtaactgtggtcgagcagagcgcctgttggac
tccaagatcggcgtgctcatcggcaagggtctccatgaacttgatgccttaaatgaccag
gaggtgaaggattttcggagtaagatgtttcggatcagtgaagagaggatgcaacaaata
caaatgatggcattctcggagtgggtgcaagcctgctactccccacagctggagcctgcg
gcagtgaccgcgatcacagccggagtcaacgatgcaccggtggacctgaaagtcattatc
cactttgaccagtcccaggactctgccagtctgaaggtgtcattgtcttgcacccccaat
gagctgatggagcaggctttgaaaaagtggctgaccacccacggatctgaggacgcagta
tggaggggtcagtatatactgagggtcagccaatgtctggaattccttggtggagaccat
ccactgattcaatacaagtacattcgctcatgcctgcaggccaaggaggctccccacctc
accctggtccacaccagcactgtaaagactatgtttgacaaggaaatctcagccattggc
gctgtggttagccgcaagtcctccaacccacctttaccgctacctcccaagagaaggcct
cccacgcaagtacagacgtgtgtgtgggacgtgcctaagccctttaggatagttcttgtg
aaaggcagcaaggtgaacgcagaggaaactgccaaggtccaggttagggcggggctcttt
cacggtacagagcttctctgcaagccggcagttagcaacgagagtagcgggcgctcagag
cacacgtggaaagacaacacagtggagtttgaaatctccgtttgtgacctgccccgcatg
acccgcctttgttttgctatctatgccgtgatggacaaggttaagaagcaaaagtccacc
aaaaatccacacatcaacaagtatcagaccatccgcaaggcggggaaagtgcactacccc
atagcttgggtaaacaccatggtgtttgactataaagggcagctgaagactggagacatc
atcctgcactgctggtcatcatttcctgatgaacttgaagagatgctgaaccccatagga
accattcagaccaacccatacactgagaacgctacagcactgcacatccacttcccagag
tactcttcacaccccatcgtcttccctccttttgacaagatactggaaaaagctgcagag
atggtcagcgctgactgtgtgtccattggtcgtggtgttaagaaattctacatggagctg
aaggagatcatggagcgtgacccggtctctcagctctgtgaaaatgaaaaggatctgatc
tggacactacgacaagattgtcgtgagactttcccccagtcgctgcccaagctgctactc
tctgtcaagtggagcaaacatgaggacatggcccagctccaggcactgctccagatttgg
cccaaactgagtcctagagatgctctggagctgctggacttcaactatcctgaccagtat
gtcagagagtatgctgtgcgctgtttaaaggacatgagtgatgaggaactgtcacagtac
ctgctacaattggtgcaggtgttgcgttacgagccctattatgactgcgccctcactcat
ttcctgttagagcgtgctcaaagaaaccgccagattggacacttcctcttctggcatcta
cggtcagagatccacatgccagctgtttcagtccagtttgcgctactcctagaagcctat
tgtagaagcaacatccctcatattgaggttctaaagaaacaggtggaagccctgagtaag
ctaaagtcagtcaatgagctgattaaattagggaccatcaagaacactcgtagtaaaacc
aaggaagcaatgttgaccaaggaggccatgatgacatgtttaagacagagtggatactcg
gagactctttcagaccttcactcccctctaaaccccagtgtcctgctgtctgacatcaat
gtggagaagtgtcggtatatggactcaaagatgaagcccctctggattgtttacaacaac
aagctgctgagtggagacaccctgggaatcatctttaagaatggagacgacctaagacaa
gacatgttgaccctccagattttgaggttaatggaccttctctggaaggaggcacatctg
gacctcagaattgtaccatatggttgcctggcaacaggcgaccgcaccgggctgattgag
gtcgtctcatctgcagaaacaatcgcaaacatccagctgaccagcagcaatgtagcagca
gctgcggcattcaacaaggatgctttgcttaactggctcaaagagaggaactctggtgat
gctcttgaccgggccatcgaggagttcactctgtcatgtgcaggctactgtgtagccact
tatgtcctgggtattggagatcgccacagtgacaacatcatggtccgcagcaatggacag
ctctttcacatagacttcggtcacatcctgggcaacttcaagtccaagtttggcatcaaa
agggagcgtgtaccatttatcctcacacacgacttcatccacgtcatacaacagggcaag
actggaaacacagaaaagtttggcagtttccgacagtactgtgaggaggcctatctaatc
ttgaggaagaatggcaacctcttcattacactgtttgccctcatgctgactgctggacta
cctgagctcacttcagttaaagacatccagtacttaaaggactccctggctctgggtaaa
actgatgaggaggccctcaagcagttccgccaaaagtttgatgaagccctgagagagagc
tggacaactaaagtgaactggatggcccacaatgtggccaaagacaaccggtcttag

KEGG   Maylandia zebra (zebra mbuna): 101469095
Entry
101469095         CDS       T02814                                 

Gene name
pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00562  Inositol phosphate metabolism
mze01100  Metabolic pathways
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze05132  Salmonella infection
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101469095 (pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101469095 (pik3cd)
   04370 VEGF signaling pathway
    101469095 (pik3cd)
   04068 FoxO signaling pathway
    101469095 (pik3cd)
   04070 Phosphatidylinositol signaling system
    101469095 (pik3cd)
   04150 mTOR signaling pathway
    101469095 (pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101469095 (pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    101469095 (pik3cd)
   04218 Cellular senescence
    101469095 (pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101469095 (pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101469095 (pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101469095 (pik3cd)
   04625 C-type lectin receptor signaling pathway
    101469095 (pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101469095 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    101469095 (pik3cd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101469095 (pik3cd)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101469095 (pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101469095 (pik3cd)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101469095 (pik3cd)
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101469095 (pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4135 DUF4037 C2
Other DBs
NCBI-GeneID: 101469095
NCBI-ProteinID: XP_004554255
UniProt: A0A3P9C6Q7
LinkDB
Position
LG20
AA seq 1039 aa
MPPGKYGMQEEWEKEGDQAINMDFLLPTGIFLKFPVSRNDTIKSIKKMVWKNARSEALFC
GLGDPDGYVFTCINETAEREELEEESRRISDVRPFMCVLRLVAREGDRVEKLTNAQISLL
IGKGLHEFEAQKNDEVNEFRTKMRAFCEEKAQDRQSLPWQKWMEYSFPCELEPCCSLPQS
LKTKNIKKIFINVKFEASDESFMLQQDPHDLPLVLMKSALKKKATVFRLMRQEPEDYTLQ
VNGRWDFIYGKHPLCQFKYIFSCLRNGQNPHLTMVHYSTVTKCQEEQGRMCNQVYKSRSL
SRPPPLPLKKQNTSSLWSINEPFHIHLVQGKRVNADEGMKLVVQAGLFHGSELLCKVVTS
SEVTVSSEPLWNQKLEFDINVADLPRMSRLCFALYGVIEKTKKPRGTKKKNKKADCPIAW
VNTMVFDYKDQLKTGEFHLSTWPCVPDEKSDLLNPMGTVEKNPNVDSAAELLIHFPNIRP
HPLYYPPLEKICDMERNGDLSLATKDEYFKLKEFMDNKNYTEFFEDEKELLWKLRTEVRD
HYPESLSKLLLITKWNKREDVVQMVNLLRNWPDLPAIHALELLDYSFPDPAVRSFTIRCL
RKLSDDELLHYLIQLVQVLKYESYLDCDLTTFLLERALSNRRIGHFLFWHLRSETHVASV
GLRFGLILEAYCRGNIHHIKLLTKQNEALGKMKALSDFVKLGSQKVTAEDLKQCIRQESY
LEALSDLLSPLNPSIILSEICTDRCRFMDSKMKPLWLMFKNPAVEGDMVGIIFKNGDDLR
QDMLTLQMIQLMENLWKKEGLDLRMIPYGCLSTGNKMGLIEVVKNSDTIANIQRNSSNSA
ATAAFNKDALLNWLKSKNPEDKLDQAIEEFTLSCAGYCVATYVLGIGDRHNDNIMIRETG
QLFHIDFGHFLGNFKRKLGINRERVPFILTYDFVHVIQQGRTNNSEKFERFREYCERAYK
ILCRNGTLFVNLFAMMKAAGLPELTSFKDIQYLKDSLALGKTEDEALKNFKVKFNEALRE
SWKTKVNWMMHSLAKDNRP
NT seq 3120 nt   +upstreamnt  +downstreamnt
atgcccccagggaagtatgggatgcaggaggagtgggagaaggagggggaccaggcgatc
aacatggacttcctgctgcctactgggatcttcctcaaattccccgtgtctcgaaacgac
accatcaaaagcatcaaaaagatggtttggaaaaatgcgagaagtgaggccctgttctgt
ggactcggcgatcctgatggatacgtcttcacctgcatcaacgagacggcggaaagggaa
gagctggaggaagaatcgaggcgcataagtgatgtgcggcccttcatgtgtgttctgagg
ctggtggcgagggagggcgaccgggtggagaaactcaccaacgcccaaatcagcctgtta
attggcaaaggtctgcatgagtttgaagctcagaagaatgacgaggtaaatgagtttcgg
accaagatgagggcgttttgcgaagaaaaggctcaagatcgacagagtctgccctggcag
aagtggatggagtacagcttcccatgtgaactggagccatgctgctccctgccgcagagc
ctcaagacaaaaaacatcaagaagatcttcattaatgtcaagtttgaggcttctgacgaa
agcttcatgctacagcaggaccctcatgacctccccttggttctgatgaagagcgctctg
aagaagaaggctaccgttttccgcttaatgcgacaggaacctgaagactacaccttacag
gtcaacgggaggtgggatttcatctatgggaaacacccactgtgtcagttcaaatacatc
ttctcgtgcttgagaaatggccagaacccccacctcaccatggtgcactactccaccgtc
accaaatgtcaggaggagcagggcagaatgtgcaaccaggtgtacaagagtcgctcctta
tccagacctcctcctctgccactgaagaagcaaaacacctcctctctgtggtccatcaat
gagcctttccacattcacctggtgcaaggcaaacgagtcaacgcagacgagggaatgaag
cttgtagtgcaggctggtctgttccatggcagcgagctgctctgtaaggtggtgacgagc
tcggaggtgacagtgagctccgagccgctgtggaatcagaagctggagtttgacataaac
gtggccgacctgccccgcatgagccgcctgtgtttcgcgctctacggcgtcattgaaaag
accaagaagccccgcggcaccaaaaagaagaacaagaaagcggattgtccaatagcctgg
gtgaacaccatggtgtttgactacaaggaccagctgaagactggggagttccacttatcc
acatggccgtgtgttcctgatgagaaaagtgacctgctgaacccgatgggaactgttgag
aagaaccctaatgtggacagcgccgctgaacttctcattcattttcccaacatccggcca
caccccctctactaccctccacttgaaaagatatgtgacatggagaggaatggtgatcta
agtttagccactaaagacgagtactttaagctcaaagaattcatggacaacaaaaactac
accgagtttttcgaggacgagaaagagctcctgtggaagctccgcaccgaagtccgcgat
cattatcctgaaagtctgtccaagctcctcctcatcaccaagtggaataagcgtgaggat
gtagttcagatggtgaatttactgaggaactggccagacctccctgccatccacgccttg
gagctcttagactacagttttcccgacccagcggttcgttctttcactatcagatgcctc
agaaagctcagtgatgatgagctgcttcattatctgatccagctggtccaggtcctgaag
tacgagtcctacctggactgtgaccttaccactttcttgttagaacgggcactgtccaac
aggaggatcggacattttctgttttggcatctcaggtcagagactcatgtggcatctgtg
ggtttgcgctttggcctgattctcgaggcctactgcaggggaaatatccatcacatcaag
ctcttaaccaaacagaatgaggctctgggcaaaatgaaggctctgagtgactttgtcaag
ttgggctcccagaaggtgacggcagaggacctgaagcagtgtatcagacaagagtcctac
ctggaggccctgtcagaccttctgtcaccactcaacccgagcatcatcctctctgagatc
tgtactgatagatgcagatttatggactccaagatgaagccactctggctgatgttcaag
aatcccgcagttgaaggagacatggtgggcattatcttcaaaaatggagatgaccttcga
caagacatgctgaccctgcagatgatccagctcatggagaatctgtggaagaaagaaggt
ctggatctcaggatgatcccgtacggctgcctgtcgaccgggaacaaaatggggctcatc
gaggttgtgaagaactctgacacaattgccaacatccagcgtaacagcagcaacagcgcc
gctaccgctgccttcaacaaggacgccttgcttaactggctcaaatcgaagaatcccgag
gacaaacttgatcaagcgatagaggagttcacactgtcctgcgctggctactgtgtagct
acttacgtcttgggcatcggagatcgtcacaatgacaacatcatgatcagggaaactgga
cagctgttccacattgattttgggcacttcctgggcaacttcaagcggaaactcgggatc
aacagggagcgcgtgccttttatcctgacgtatgactttgtccacgtgatccagcaagga
cgaacaaacaacagtgagaaatttgagaggttcagggagtactgtgagcgggcctataag
atcctgtgtcggaacgggacgctgtttgtcaacctcttcgccatgatgaaggcagcgggg
ctacctgaactcacgtccttcaaagacatacagtatctaaaggactctttagcgctgggc
aaaacagaggacgaggcgctgaagaacttcaaagtaaagttcaacgaagccttgcgggaa
agctggaagaccaaggtcaactggatgatgcactcactggccaaagataatagaccatga

KEGG   Maylandia zebra (zebra mbuna): 101470898
Entry
101470898         CDS       T02814                                 

Gene name
pik3r1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101470898 (pik3r1)
   04370 VEGF signaling pathway
    101470898 (pik3r1)
   04068 FoxO signaling pathway
    101470898 (pik3r1)
   04070 Phosphatidylinositol signaling system
    101470898 (pik3r1)
   04150 mTOR signaling pathway
    101470898 (pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101470898 (pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    101470898 (pik3r1)
   04218 Cellular senescence
    101470898 (pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101470898 (pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101470898 (pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101470898 (pik3r1)
   04625 C-type lectin receptor signaling pathway
    101470898 (pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101470898 (pik3r1)
   04914 Progesterone-mediated oocyte maturation
    101470898 (pik3r1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101470898 (pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101470898 (pik3r1)
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101470898 (pik3r1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP AAA_13 SH3_1 SH3_9 SH3_2 Laminin_I RNA_binding BRE1
Other DBs
NCBI-GeneID: 101470898
NCBI-ProteinID: XP_004549978
LinkDB
Position
LG7
AA seq 729 aa
MSAEGYQYRALYDYKKEREEDIDLHVGDILLVSKGELVALGVTDGLEQRPDEIGWLPGFN
ETTQEKGDFPGTYVEYIGKKWISPPTPKPRPLRPLPVAPASSFKSEMDSDSEQGFFLPDL
TEQFSLPEIAPPILIKLLEAIERKGLDNPTLYRTFNAGAGLEVRQYFDCDPPSADLDHLE
LPVLCDGLRRYLQDLPQPIIPTAIYAQMVHSAKEVVNPEECAQLLRRFASAPGRPPQYWL
TLHCLLRHFARVCQNGSKNLLSARSLGEIFSPVFFRQQATSCEPSLDSHIKIIEVLVTSE
WSDSQAAPALPPKPPKPTSVINNGMNNNMALQDAEWYWGDISREEVNEKLRDTADGTFLV
RDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYN
PKLDVKLLYPVSKHQQDQVVKEDNIEAVGRKLCEYHQQYQEKNKEYDRLYEEYTRTSQEI
QMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFRREGNEKEIQRIMGNYEKLKSRISE
IVDSKRRLEEDLKKQAADYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEW
LGIKNESTEDQYSMVDDDEDLPHHDERTWKLGNINRLQAEAILQGKRDGTFLVRDSSKAG
CYACSVVVDGEVKHCVINKTPTGYGFAEPYNLYNSLKELVLHYQHTSLVQHNDSLNVTLA
YPVYAQQRR
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgagtgctgaagggtatcagtacagagcactttatgattataaaaaagagagggaggag
gacattgatctgcatgttggggatatattgttggtaagcaaaggagagctggtggctctt
ggggtcaccgatggcctggagcagcggccagatgagattggctggttgccaggctttaac
gagaccactcaggaaaaaggggactttcctggcacctatgtagagtacattgggaagaaa
tggatctctccccctacacccaagccaaggcccctgagacccttacctgtagctccagcc
tcctccttcaagtcagagatggactcggactcagaacaaggtttcttcttgcccgacttg
acggagcagttttcccttccagagattgctccacctattttgatcaaactgcttgaagca
attgagaggaaaggtctggataaccccacattatatagaacatttaacgctggtgctgga
cttgaagtcaggcagtattttgattgtgaccccccatctgcagacttggatcacctggag
cttccagtcctgtgtgacggtctgcgtaggtacttgcaggatcttccccaacccatcatt
cccactgcaatatatgctcagatggttcacagtgctaaagaggtggtgaatcctgaggaa
tgtgcccagctactacgtcgctttgctagcgccccaggccgtcctccccagtactggctg
actctccactgtctgctaaggcattttgctagagtgtgccaaaacggttccaagaacctg
ctcagtgccagatcgctgggcgagatcttcagccctgtgtttttcagacaacaggccacc
agttgtgaacccagtctggattctcacatcaagatcattgaggttctggtgaccagtgag
tggagtgacagtcaagctgcaccagctctacctccaaagccacccaagcccacatctgtg
attaacaacggtatgaacaacaacatggcgctacaagatgctgaatggtactggggagac
atctcaagggaggaggtcaatgagaaactgagggacactgcagatggtacgtttttggtg
cgggacgcctctacaaaaatgcacggagactacactctgactttgaggaaaggaggaaac
aacaagcttatcaagatattccatcgagatggtaaatatggcttctctgatccactaacc
ttcaactcagtcgtcgagctcatcaaccactatcgcaacgagtccctggctcagtacaac
cccaagctagacgtcaagctgctgtaccccgtgtctaaacaccagcaggatcaagtggta
aaagaggacaacatcgaagctgtgggcaggaagctctgcgagtaccaccagcaataccaa
gaaaagaacaaagagtacgaccgtctctatgaagagtacaccagaacatcacaagaaatc
caaatgaaaaggacggcgatagaggctttcaatgaaactatcaaaatattcgaggagcaa
tgccaaacacaagagcgctacagcaaggagtatattgagaaattcaggagagaaggcaat
gaaaaagagattcagaggatcatgggaaattacgagaagttgaaatcgaggattagtgaa
atagtagacagcaagcgcaggctggaagaagacttgaagaaacaggcagcagactacagg
gagatcgacaagaggatgaacagcatcaagcctgacctcatccagctccgcaagaccaga
gaccagtatctcatgtggttgacccagaagggagtcaggcagaaaaaactcaacgagtgg
ctgggaatcaagaacgagagcacagaagatcaatattctatggtggacgatgatgaagac
cttcctcatcatgatgagcgaacctggaagctgggcaacatcaatcgcttacaggcggag
gcgatcctccagggcaagagagacggaacattcctggttcgagacagcagcaaagcggga
tgctacgcctgcagtgtggttgtggacggcgaggtgaaacactgcgtcatcaacaagacc
cccacagggtacggcttcgctgaaccttataacctgtacaactcattaaaagaactcgtt
cttcactaccagcacacgtctttggtccagcacaatgactctctgaatgtgacactagcg
taccctgtgtacgctcaacagagacgatga

KEGG   Maylandia zebra (zebra mbuna): 101473981
Entry
101473981         CDS       T02814                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00562  Inositol phosphate metabolism
mze01100  Metabolic pathways
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze05132  Salmonella infection
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101473981
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101473981
   04370 VEGF signaling pathway
    101473981
   04068 FoxO signaling pathway
    101473981
   04070 Phosphatidylinositol signaling system
    101473981
   04150 mTOR signaling pathway
    101473981
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101473981
  09143 Cell growth and death
   04210 Apoptosis
    101473981
   04218 Cellular senescence
    101473981
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101473981
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101473981
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101473981
   04625 C-type lectin receptor signaling pathway
    101473981
  09152 Endocrine system
   04910 Insulin signaling pathway
    101473981
   04914 Progesterone-mediated oocyte maturation
    101473981
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101473981
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101473981
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101473981
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101473981
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101473981
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF5314 C2
Other DBs
NCBI-GeneID: 101473981
NCBI-ProteinID: XP_004570542
UniProt: A0A3P9BH40
LinkDB
Position
LG18
AA seq 1068 aa
MAPRPSSGELWGMHLMPPSILVDCLLPNGMILTLECLREATLTTVKHELFKEARKYPLYH
LLQEESSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILNREIGFA
IGMPICEFDLVKDPEVQDFRRNILNVCKEAVDLRDSNGPHSRALYVYPPNVESSAELPRH
IYSKLDKGQIIVVIWVIVSPTNDKQKYTLKINHDYVPEQVIAEAIRKKTRSMLLSQEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYVRSCIMLGRMPNLMLMSKDSLYSQLPMD
FFTMPSYARRISTATPYMNGETATKNLWTINGTLRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTLRVPCSNPRWNEWLTYDMYIPEVPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVAGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDHY
SSPVKFPDMSTIEDHANWNISRELGFNYCHTGLSNRLARDNPLTDGDNEQLRQVCNRDPL
SEITEQEKDFLWRHRHDCINMPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNFPDPMVREFAVKCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDLLK
QEKKDEAQKVQMKFLVEQMKRPDYMDALQSFTSPLNPAHQLGNLRLEECRMMSSAKRPLW
LNWENPDMMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEMYDQAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKSEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHAMN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atggctcccagaccatcatcgggagaactatgggggatgcacttgatgccccccagcatt
ctagtggactgccttctgccaaatggcatgattctcacgttggagtgcctccgggaggcc
acacttactacagtcaagcatgagcttttcaaagaggccaggaagtaccctctctaccat
ctgctgcaggaggagagctcctacatctttgttagtgtcacccaggaagcagagcgggag
gagttttatgatgagaccaggaggttatgtgatcttaggcttttccaggccttcctcaag
gttattgagccagtaggcaacagagaagagaagattctcaacagagagataggttttgct
attggtatgcctatatgtgagtttgatttggtgaaagaccctgaggtgcaggacttcaga
aggaacattttaaacgtttgcaaagaagctgtggacctcagagacagcaacggaccccac
agcagagcattgtacgtctaccctcccaatgttgaatcctcagcagagcttcccaggcac
atctatagcaagctagacaaaggtcaaatcattgtggtcatttgggtcattgtttcgccc
accaatgacaaacagaagtacaccctgaagatcaatcatgattatgtaccagagcaagtg
attgcagaagccattcggaagaagacgcgcagcatgctgctctcccaggagcagttaaag
atgtgtgtgcaggagtatcagggaaagtacatcctcaaagtctgcggctgtgatgagtac
ttactggagaaataccctctgagtcagtacaagtatgtgcgcagctgtatcatgctggga
agaatgcctaacctgatgctaatgtcaaaagacagcctgtattcccaactgcccatggat
ttcttcaccatgccgtcatatgcaaggcgaatatccacagcaacaccctacatgaatggg
gaaacagccaccaagaatctgtggactatcaacggaacgctaaggattaagatactgtgc
gccacttatgtcaatgtcaacatcagagacattgacaagatctatgtcaggactgggata
taccatggtggagagcagctgtgcgacaatgtcaacacgctacgtgtgccgtgctcaaac
cccaggtggaacgagtggctgacttacgacatgtacattccagaagttccccgagctgcc
cgactctgcctctccatttgctctgtcaaaggacggaagggagctaaagaggaacactgt
cccctcgcctggggcaacattaacctgtttgactacacccacacactagtagcagggaag
atggctctcaacctgtggcctgtcccacatggcctggaagacctgctcaaccctatcggt
gtcacgggctccaaccctaacaaggaaaccccatgtctggagctggagtttgaccattac
agctcccctgtcaagtttcctgatatgtctaccattgaggatcatgcaaactggaacata
tccagagagcttggctttaattactgccacactggtttgagtaacagactggcacgggac
aaccccctgactgacggcgacaatgagcagctacggcaagtgtgtaacagagacccgctt
tctgaaatcactgagcaggagaaggacttcctgtggagacacagacatgactgcatcaat
atgccagagatccttcccaagatcctcctggctgtgaagtggaactccagagatgaggtt
gcacagatgtattgccttctaaaggactggcctgctatcaaaccagaacaagccatggag
ttgttggattgcaacttccccgatcctatggtcagagagtttgctgtgaagtgccttgag
aaatacctaactgatgacaaactctcccagtatctcattcagctggttcaggttctgaag
tacgagcagtaccttgataacccactcgcacggttcctgctgaaaaaggcgttaaccaat
cagaggataggacatttcttcttctggcatttaaagtcagagatgcacaacaagacagtg
agccagcggtttggtctgcttctggagtcctactgccgggcctgtggcatgtatctgaag
cacttgagcagacaggtggaggccatggagaagctcatcaatctcactgacctcctcaaa
caggagaaaaaagatgaggctcagaaggttcaaatgaagtttctggtggagcagatgaaa
agacctgactacatggatgcactgcaaagcttcacctctccgctgaatccggcacatcag
ctgggaaacctccgcctggaggaatgcaggatgatgtcgtcagcaaagagacctctgtgg
cttaactgggaaaacccagatatgatgtcggagctgctctttcagaacaatgaaatcatc
ttcaaaaatggagatgatctgaggcaggacatgctgacgctacagatcattaggataatg
gagaacatctggcagaaccaaggccttgatctcaggatgctgccctatggctgtttgtct
atcggcgactgcgtgggtttgatcgaggtggtgaggaactctcacaccatcatgcagatc
cagtgcaaaggaggcctaaagggggcgctgcagttcaacagccacactctacatcagtgg
ctcaaggataagaacaagggagagatgtacgaccaggccatcgatctgttcacacggtcg
tgcgcaggctactgtgtagctacatttatcctgggcataggagataggcacaacagcaac
atcatggttaaagatgatgggcagctgttccacatagattttggtcacttccttgaccac
aaaaagaagaagtttgggtacaagagggagcgcgtcccctttgtgctcacacaggacttt
ttgattgttattagcaaaggaacgcaagagtgcaccaaaacgagggagtttgaaagattc
caggagatgtgctacaaagcgtacctggcaatccggcagcacgccaacctcttcatcaac
ctcttctccatgatgctgggctcgggaatgcctgagctgcagtcgttcgacgacatcgct
tacatcaggaagaccctggccctggacaagtcggagcaggaggccctggactacttcatg
aagcagatgaacgacgctcaccacggcggctggactaccaagatggactggatcttccac
acgattcgccagcatgccatgaactga

KEGG   Maylandia zebra (zebra mbuna): 101474114
Entry
101474114         CDS       T02814                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00562  Inositol phosphate metabolism
mze01100  Metabolic pathways
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze05132  Salmonella infection
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101474114
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101474114
   04370 VEGF signaling pathway
    101474114
   04068 FoxO signaling pathway
    101474114
   04070 Phosphatidylinositol signaling system
    101474114
   04150 mTOR signaling pathway
    101474114
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101474114
  09143 Cell growth and death
   04210 Apoptosis
    101474114
   04218 Cellular senescence
    101474114
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101474114
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101474114
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101474114
   04625 C-type lectin receptor signaling pathway
    101474114
  09152 Endocrine system
   04910 Insulin signaling pathway
    101474114
   04914 Progesterone-mediated oocyte maturation
    101474114
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101474114
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101474114
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101474114
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101474114
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101474114
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 PI3K_rbd PI3K_p85B DUF2321 C2
Other DBs
NCBI-GeneID: 101474114
NCBI-ProteinID: XP_014268487
LinkDB
Position
LG3
AA seq 1070 aa
MVPRPSSGELWGLHLMPPRILVDCCLPNGMMVSLECLRETPLISIKQQLFSEARKYPLYH
LLQEESCYIFVGVTQEAEREEFYDETRRLCDLRLFHPILKVIEPLGNREEKILNREIGFA
IGMPVCEFEMMKDPEVQDFRRSILSVCREAMEEREGGGAHSQALYVYPPNVESSPQLPQH
IYSKLDKGRLIVTIWVIVSPSNSKQKYTLKVSHDSLPEQLIAESIRKKSRSMHLSPQQLR
LCVQEYQGQYILKVCGCDEYLLEKFPLSQYKYIRSCIIVGRLPHLMLVSKDSLYSQLPAS
GFVTPSYSRRTPQPSPCPGGGDGSPPRSLWAFNTLLRVRLLCATYVNVNIRDIDKIYVRT
GIYHGGEPLCDNVNTQRVPCSNPRWNEWLTYDIYLADLPRSARLCLSICSVKGRKGAKEE
HCPLAWGNVNLFDYKDILVCGKVALSLWPVPHGLEDLLNPIGVAGSNPNKETPCVELEFS
WFNQIVVFPDEQQIEEHANWTISRELGYNYCHGLSSRLACDSSVSSGDAEQLRSLCSRDP
LYELSEQEKDFLWRHRHYCVNIPESLPKLLLSVKWNSRDEVSQMYCLLKEWPLMEPESAL
ELLDCNFPDPMVREFALRCLVQGLTDDKLSQYLLQLVQVLKYEMYLDNPLARFLIKKALT
NQRIGHFFFWHLKSEMHNKTVSRRFGLLLEAFCRACGMYLKHLNRQVEAMDKLVNLTDTL
KQEKKDETQKTQMKFLVEHMSRPDYMEALQGFVSPLNPVHQLGNLRLEECRIMSSAKRPL
WLNWENPDIMSELLFTNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCL
SIGDCVGLIEVVKNSFTIMQIQCKGGLKGALQFNSNTLHHWIKDKNRGEAYDRAIDLFTR
SCAGYCVATFILGIGDRHNSNIMVKENGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQD
FLIVISKGIQESTKTKEFERFQEMCYKAYLAIRQHASLFINLFSLMLGCGMPELQSFDDI
AYLRKTLALEKSQQEALEYFTKQMNDAHHGGWSTKMDWIFHTIRHMPNEH
NT seq 3213 nt   +upstreamnt  +downstreamnt
atggtgcccaggccatcgtcaggggaactatgggggctccacctgatgcccccccggatc
ctggtggactgctgcctgcctaacggtatgatggttagcctggagtgtctgagggaaact
cctctcatcagtatcaagcagcagctcttctccgaggccaggaagtaccccctgtaccac
ctgctgcaggaggagtcgtgctacatctttgtgggcgtgacccaggaggctgagagggag
gagttttacgatgagacgaggcggctgtgcgacctgcgcctgttccaccccatccttaag
gtcatcgagcccctcggcaaccgtgaggagaaaatcctgaaccgtgagatcggtttcgcc
atcgggatgccggtctgcgagtttgagatgatgaaggacccggaggtccaggacttccgc
cgttccatactgagcgtgtgcagagaggccatggaggaacgggaaggagggggggcccac
agccaggcgctctacgtttacccccccaacgtggagtccagtccccagctgccccagcac
atctatagcaagctggacaaagggcgcctgattgtgaccatctgggtgatcgtgtctcca
tcaaactccaaacagaagtacaccttgaaggttagtcacgacagtttacctgagcagctg
atcgccgagtccatcaggaagaaaagccgatcgatgcacctttcacctcagcagctccgc
ctctgcgttcaggagtaccagggccagtacatccttaaggtgtgtggctgcgatgagtac
ctgctggagaagtttcctctcagtcagtataagtacatccgctcctgcatcatcgtggga
cgtcttcctcacctgatgctcgtgtccaaagacagcctctactctcagcttcccgcctca
ggcttcgtcacgccttcctacagccgtcggactcctcagccgtctccctgtccaggagga
ggcgacggttctcctcctcgctccttgtgggccttcaacactctgctgagagtccggctg
ctctgcgccacgtacgtgaacgtgaacatcagagacatcgataagatctatgtgaggaca
gggatctatcacggaggagagccgctctgtgacaacgtcaacacccagagagtgccctgc
tccaaccccaggtggaatgagtggctgacctatgacatctacctggctgacctccctcgt
tcagccagactctgcctgtctatctgctctgtgaagggaaggaaaggagctaaggaggag
cactgccctctggcctgggggaatgtaaacctgtttgactacaaggacatcctggtctgt
ggtaaggtggctctcagcctgtggcccgttccccatggcctagaggacctgctcaacccc
attggagtcgcgggttcaaatcccaacaaggagaccccctgcgtggagctggagttctcc
tggttcaatcagatcgttgtttttcctgacgagcagcagattgaagagcacgccaactgg
accatcagcagagaactgggctacaactactgccacggcctgagcagccgtttggcctgt
gacagcagtgtttcgtcaggcgatgccgagcagcttcgctctctctgctccagagatccg
ctgtacgagctctcggagcaggagaaggacttcctctggagacacagacattattgtgta
aacatcccagagtctctccctaagctgcttctttctgtcaaatggaactccagagacgaa
gtttctcagatgtactgtctgttgaaggagtggcctctgatggagcccgagtcggctctc
gagttgttggactgtaactttcccgacccaatggtccgagagtttgcgctgcgctgcctc
gtgcagggcctgacggatgacaagctgtcgcagtacctgttgcaacttgtacaggtgttg
aagtatgagatgtacctggacaatcctctggcccgtttcctgataaagaaagctctgacc
aatcagaggatagggcacttcttcttctggcacctgaagtcagagatgcacaacaagacg
gtttcccgacgcttcggtctgctgctggaagctttctgcagagcctgcgggatgtacctg
aagcacctgaacagacaggtagaggccatggataaactggtgaatctgaccgacacactg
aagcaggagaagaaggacgagactcagaaaactcagatgaagtttctggttgagcacatg
tctcgtccagattacatggaagctctgcagggattcgtctctccactgaatccagttcac
cagctgggaaatctcaggctggaggagtgtaggatcatgtcctcggcaaagcgccccctg
tggctgaactgggaaaaccctgacatcatgtccgagcttctcttcaccaacaacgagatc
atcttcaagaacggagatgacctgcgtcaggatatgctaacgttgcagattattaaaatc
atggagaacatctggcagaaccagggtctggacctgcgcatgttgccctatggatgcctc
tccatcggtgactgcgtgggtctgatcgaggttgtgaagaacagcttcaccatcatgcag
attcagtgcaagggaggcctgaagggggcgctgcagttcaactccaacacgctgcatcac
tggatcaaagacaagaaccgcggcgaagcgtacgatcgggccatcgacctgttcacgcgc
tcatgtgctggttactgcgttgccacgttcatcctgggaatcggagaccgccacaactcc
aacattatggtgaaagagaatggacagctgttccacattgactttggtcacttcctggat
cacaagaagaagaaatttggctacaagagggagcgtgtaccctttgtccttactcaggac
ttcctcatcgtcattagtaaaggcatccaggaatccaccaagaccaaggagttcgagagg
ttccaggagatgtgctacaaagcatacctcgccatccgtcagcacgccagcctcttcatc
aatctcttctcccttatgctgggttgcgggatgcctgaactgcagagctttgatgacatt
gcctacctgaggaaaaccctggccctggagaagagccagcaggaggcactggagtacttc
accaagcagatgaacgacgctcaccacggcggctggagcacgaagatggactggatcttt
cacaccataagacacatgcccaatgagcactga

KEGG   Maylandia zebra (zebra mbuna): 101478000
Entry
101478000         CDS       T02814                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101478000
   04370 VEGF signaling pathway
    101478000
   04068 FoxO signaling pathway
    101478000
   04070 Phosphatidylinositol signaling system
    101478000
   04150 mTOR signaling pathway
    101478000
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101478000
  09143 Cell growth and death
   04210 Apoptosis
    101478000
   04218 Cellular senescence
    101478000
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101478000
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101478000
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101478000
   04625 C-type lectin receptor signaling pathway
    101478000
  09152 Endocrine system
   04910 Insulin signaling pathway
    101478000
   04914 Progesterone-mediated oocyte maturation
    101478000
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101478000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101478000
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101478000
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Exonuc_VII_L
Other DBs
NCBI-GeneID: 101478000
NCBI-ProteinID: XP_004567192
UniProt: A0A3P9BSV6
LinkDB
Position
LG18
AA seq 467 aa
MIYPPEGLFYIEMDQAPALPPRSTKPPSSTMNSNCLSPPAHSLQDAEWYWGDITREEVNE
KLRDTPDGSFLVRDASTKLQGDFTLTLRKDGHNKLIKIYHRDGKYGFSDPLTFTSVVELI
WYYEHHPLVEYNASLDLMLTHPVSRFQQVKEDSVDVTGRKLKEVHSQYQEKSKEFDRLYE
AFTKTSQEIQMKRTAIEAFNETMMIFEEQCREQERYGEEFERSSHLEGIDKDLESFLIHY
EKLKCRLAEIYDSKIHLEEDLRTQVEDYRETDRKINNLRPDLIQLRIMRDQYLNWLNHKG
VRQKRINDWLGAHNDSLDDTYVLKGDEKNLPHQDETSWFVGELSRTQAEEMLQGKVPGTF
LIRESSKQGCYACSVVVNEEVKHCMIYSTPHGYGFAEPYDVHCSLKDLVLHYRLHSLVQH
NDALDVRLSHPVHAKAAATPSQHAEEQHKLIQTPKHTSGMAPAAPEM
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgatttatcctcccgaaggtttattctacatcgaaatggaccaagcaccagctctccct
cccaggtcaacaaagccaccatcttccaccatgaacagcaactgcctttcgcctcctgcg
cattcgctacaggacgctgaatggtactggggtgacataacaagggaggaggtaaacgag
aagctccgagacacacctgatggctcctttctggtgcgcgatgcatccacaaagctgcag
ggagactttacgctgacattaagaaaagacgggcacaacaagctgatcaagatttaccac
cgtgacgggaagtatggcttctcagaccctctcacattcacgtcggtggtggagctcatt
tggtactatgagcaccatccgttggtggaatataatgcctcactggatctgatgcttacc
catcctgtgtcccgtttccagcaggtgaaagaggacagtgtggatgtgactggaagaaag
cttaaggaggtccacagtcagtaccaagagaaatcaaaggagtttgatcgtctctacgaa
gccttcacaaagacctcacaggagatccagatgaagcgcacggcgatagaggcttttaat
gagactatgatgatctttgaggagcagtgtcgtgagcaggagcgctacggagaagagttt
gagagaagcagccatttggagggaattgacaaagatttggagagctttctgatacactac
gagaagctgaagtgccgtctcgcagagatctatgacagcaaaattcatttagaggaagac
ttgaggacgcaggtggaggattacagagagacggacaggaagattaacaacctgcggcca
gacctcatccagctacgcatcatgagagaccagtacctcaactggcttaatcacaaaggc
gtacggcagaaacgcataaatgattggctgggggcacataacgacagccttgatgatacg
tatgtgctaaagggagatgagaagaatttgccacatcaggatgagacgagctggtttgtt
ggtgaactgagtcggacgcaggcagaggagatgcttcaaggcaaagtccctggaacattt
ctgatccgcgagagcagcaaacagggatgttacgcctgctccgttgtcgtaaacgaagaa
gtcaagcattgcatgatctacagcacaccgcacggatacggctttgccgagccctatgat
gtccactgttcactgaaagaccttgtcctgcactatcgcctgcactcattagtgcaacac
aatgacgccctggatgtgcggctgtcacatccggtgcacgccaaagctgcagccacacct
tcacagcacgcagaggaacaacacaaactgatacagactccaaaacacacgtcggggatg
gcccctgccgctccggagatgtaa

KEGG   Maylandia zebra (zebra mbuna): 101481450
Entry
101481450         CDS       T02814                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101481450
   04370 VEGF signaling pathway
    101481450
   04068 FoxO signaling pathway
    101481450
   04070 Phosphatidylinositol signaling system
    101481450
   04150 mTOR signaling pathway
    101481450
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101481450
  09143 Cell growth and death
   04210 Apoptosis
    101481450
   04218 Cellular senescence
    101481450
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101481450
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101481450
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101481450
   04625 C-type lectin receptor signaling pathway
    101481450
  09152 Endocrine system
   04910 Insulin signaling pathway
    101481450
   04914 Progesterone-mediated oocyte maturation
    101481450
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101481450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101481450
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101481450
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_2 SH3_9 RNA_binding Laminin_I Mod_r PI_PP_I Bap31_Bap29_C
Other DBs
NCBI-GeneID: 101481450
NCBI-ProteinID: XP_014267942
UniProt: A0A3P9AWT4
LinkDB
Position
LG12
AA seq 717 aa
MSSEGFQYRALYDYKKEREEDIDLHVGDVLLVTKGALLALGCTNGAEERPSEIGWLPGFN
ETTQEKGDFPGTYVEFVGRKRMSPPTPKPRPPRPPSAASVRADSESEGLVLPDLPEQFGP
PDTAPPLLSRLMEAIETKGLDSPGLYRSLSGGGVDTQQLADADLEQLEAPSLCDGVVRFL
QDLPGPVLPASLQADMIHAVQEVRDLEECAQLLRSVASSPTCPAQYGLTLLSVVRHLARL
CLHGSRNQLSPRNLAESFSPLLFRQTAGSESGLDPLVQVLEVLITSELNMNQAAPALPPK
PVKSSAPAPSTSFNNSMVLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYT
LTLRKGGNNKLIKIFHREGKYGFSDPLTFSSVVELINHYRHESLAQYNPKLDVKLLYPVS
KHQQDQVVKEDSIEAVGKKLHEYHLQYQEKNREYDRLYEEYTRTSQEIQMKRTAIEAFNE
TIKIFEEQCQTQERFSKEYIEKFRREGNDKEIQRIMENYDKLKSRISEIVDSKRHLEVDL
KKQAADYREIDKKMNSIKPDLIQLRKTRDQYLMWLTQKGVRQRRLNEWLGLKNETTEDEY
SMVEDEEDLPHHDERLWRLGNINRSQAESLLRGKRDGTFLVRDSSKPGCYACSVVVDGEV
KHCVINKTSTGYGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVTLAFPVYSQQRR
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgagctcggagggctttcagtaccgagcgctctacgactacaagaaggagagggaggag
gacatcgacctgcacgtcggggacgtgctgctggtcactaagggggcgctgctggcgctc
ggctgcaccaacggagccgaagaacggccgtcggaaatcggctggctgcctggtttcaac
gaaaccacacaggaaaaaggcgacttcccgggaacgtatgtggagtttgtcggcaggaag
cggatgtctccacccaccccgaagccccgcccacccaggcccccatctgcagcgtcggtg
agggccgactcggagtcagagggtctcgtgctgccggacctccccgagcagttcggaccc
ccggacacggccccgcccctcctcagcagactgatggaggccatagagaccaaaggtttg
gacagccccggcctgtatcgcagcctcagcggcggcggcgtggacacgcagcagctcgca
gacgcagacctggagcagctggaggcgccgtccctgtgtgacggggtggtgcggttcctg
caggatctccccggtcccgtcctgccagcctcgctgcaggccgacatgatccacgccgtt
caagaggtcagagacctagaggagtgcgcccagttgctgcggagcgtggccagctcgcca
acttgccccgcccagtatgggctgaccttgctcagcgtggttagacacctggcccgactg
tgcctgcacggctccaggaaccagctgagcccccgaaacctcgccgagagcttcagcccg
ctgctgttcagacagacagccgggtctgagtcgggtctggatcctctggttcaggtcctg
gaggttctgataaccagcgagctcaacatgaaccaggccgcaccagctttacctcctaaa
cctgtgaagtcttcggctccggctccttccaccagtttcaacaacagcatggttctgcag
gacgccgagtggtactggggagacatttccagggaggaggtgaacgagaagctgagggac
acggccgacggtacgtttctggtccgagacgcctccaccaagatgcacggagattacact
ctgactctgaggaaaggaggcaacaacaagctgataaagatcttccatcgggaggggaag
tacggcttctccgaccccctgaccttcagctcggtggtggagctgatcaaccattacaga
cacgagtctctggcccagtacaaccccaaactggacgtcaagctgctctacccggtctcc
aagcaccagcaggatcaggtggtgaaggaggacagcatcgaggcggtggggaagaagctg
cacgagtatcacctgcagtaccaggagaagaaccgagagtacgacaggctgtacgaggag
tacaccagaacgtcgcaggagatccagatgaagaggacggccatcgaggcgttcaatgag
accataaagatcttcgaggagcagtgtcagactcaggagcgcttcagcaaagagtacatc
gagaagtttcgccgggagggaaacgacaaggagatccagaggatcatggagaactacgac
aagctcaagtcccgcatcagcgagattgtggacagcaagcgccacctggaggtggacctg
aagaagcaggcggccgactaccgagagatcgacaagaagatgaacagcatcaaaccggac
ctgatccagctccgcaagaccagggaccagtacctgatgtggctgactcagaaaggcgtt
cggcagaggaggctgaacgagtggctcggcctgaagaacgagaccacagaggacgagtac
agcatggtggaggatgaggaggaccttcctcatcacgacgagcgtctgtggcgcctcgga
aacatcaaccgcagccaggcggagtctctgctgcgagggaagagggacggcaccttcctg
gtgcgggacagcagcaagccgggctgctacgcctgctccgtggtggtggatggcgaggtg
aagcactgcgtcatcaacaagacgagcaccggctacggcttcgccgagccctacaacctg
tacggctcgctgaaggagctggtgctgcactaccagcacacgtcgctggtccagcacaac
gactcgctcaacgtcacgctggccttccccgtctacagccagcagagacggtga

KEGG   Maylandia zebra (zebra mbuna): 101484093
Entry
101484093         CDS       T02814                                 

Gene name
pik3r2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101484093 (pik3r2)
   04370 VEGF signaling pathway
    101484093 (pik3r2)
   04068 FoxO signaling pathway
    101484093 (pik3r2)
   04070 Phosphatidylinositol signaling system
    101484093 (pik3r2)
   04150 mTOR signaling pathway
    101484093 (pik3r2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101484093 (pik3r2)
  09143 Cell growth and death
   04210 Apoptosis
    101484093 (pik3r2)
   04218 Cellular senescence
    101484093 (pik3r2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101484093 (pik3r2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101484093 (pik3r2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101484093 (pik3r2)
   04625 C-type lectin receptor signaling pathway
    101484093 (pik3r2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101484093 (pik3r2)
   04914 Progesterone-mediated oocyte maturation
    101484093 (pik3r2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101484093 (pik3r2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101484093 (pik3r2)
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101484093 (pik3r2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 Mod_r Laminin_I DUF730 DUF4188
Other DBs
NCBI-GeneID: 101484093
NCBI-ProteinID: XP_004542460
UniProt: A0A3P9B4I9
LinkDB
Position
LG18
AA seq 735 aa
MAVEGFQYRALYTFTKDQDEDLDLQPGDLLTVSKASLMSMENYQEGCVEHPERLGWLLGY
NERTKQRGDFPGTYVEYVGPIKMALPSSQPRSQRPLPAAPKPESTQAVPVPDLSEQFTPP
ETAPPALVGLIQAIEKRGLDCKTLYRTPSSSGSDSPVYSLCSESDVVQRDLGFLSESVLQ
YLRDLPSPVIPACVYPHLQTALMQQHVLQQSADGAVAGSHNREVSLVLENSTTVPLHHRL
TLQYLLTHLAKVTQAQASNGLDTNTLGKIFGPLLIWTGPSTAWFPMDDEFPTLVVEKLLI
ERTTGQDLTPPVLPAKPVKSKMTPSAMTDTSSLLNDAEWYWGEISREEVNEKMRDTPDGT
FLVRDASSKLEGEYTLTLRKGGNNKLIKIYHRDTRYGFSEPLTFLSVVELINHYRHESLA
QYNGKLDTKLLYPISKYQQLVKENSIEEVGEQLKIYHEQYQEKSREYDSLYEEYTHTSQE
LQMKRTAIEAFNETIKIFEEQFETQERYSKESLERFQREGNEKEIQKIQSNSERLQSRVK
EIHDSKCKLEQDLREQVSDNREIDKKMNSLKPDLMQLRKIRDQYLIWLTQKGTRQKKINE
WLGIKNDADDSFSLEEDEGSPHHDECTWYVGDIKRTQAEEMLRGKCDGTFLIRESQSQKG
SYACSVVVDGDSKHCVIYKTVTGYGFAEPYNLYSSLKDLVLHYKNVSLVQHNDQLNVNLA
YPVLARSQNQNQHPR
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggcggtggaaggtttccagtaccgtgccctctacacgttcaccaaggaccaggacgag
gacttggatctgcagcctggagaccttcttacagtcagcaaggcctctctgatgtccatg
gagaactaccaggagggctgcgtggagcaccccgagcgtctgggctggctcctcgggtac
aacgagcgcactaagcagagaggcgacttcccagggacgtatgttgagtatgtgggcccc
atcaagatggcactcccatcgagtcagccaaggtcccagcgacccctgcctgcagctccc
aaaccagagtcaactcaagctgttcctgtgccggacctgagcgagcagttcacaccacca
gagacggctcccccggccctcgtcggcctcatacaagccatagaaaagagaggtctggat
tgcaagacgttgtacaggacacctagctcctcaggttcagatagtccggtgtacagcctg
tgctctgagagtgacgtggttcagagggatctaggtttcctgtctgagagcgtcctgcag
tacctgagagaccttccatcacctgtcatccctgcctgtgtctaccctcacctacaaact
gctctcatgcagcagcatgtcctacagcagtcagcagatggtgcggtagctggaagccac
aacagagaagtcagcctggtgcttgagaactcgaccaccgtccctctccatcaccgtctc
accctgcagtatctcctcacacacctggctaaggtcactcaggcacaggccagcaatggc
ctggatacaaacacgctgggaaagatctttggccccctgcttatctggaccggcccctcc
actgcttggtttccaatggatgatgagttccccaccttggtggtggagaaattgctgata
gagagaactacaggtcaagacctcactcctccagttctcccagcgaagcctgtgaagtca
aaaatgacaccatcagccatgacagacacgagcagcctgctgaatgatgcagagtggtac
tggggcgaaatatccagagaggaggtgaatgagaaaatgcgagacactccagacggcacc
tttctggtccgagatgcttcaagtaaattggagggcgagtacactcttacactcaggaag
ggggggaacaacaagcttataaagatttatcacagagacacgcggtatggtttctcagag
cctctgaccttcctgtctgtagtggagctcatcaatcactaccgccacgagtcactggcc
cagtacaacggcaagttggacacaaaacttctgtatcccatctccaaataccagcagctg
gtgaaggagaacagcatagaggaggtgggagagcaactgaagatctatcatgagcagtac
caggagaagagtcgcgagtacgactctctgtacgaggagtacacacatacctcgcaggag
ctgcagatgaaacgcacagccattgaagccttcaacgagaccatcaagatctttgaagag
cagtttgagactcaggagcggtacagcaaagagtctttggagagattccagcgtgagggc
aacgaaaaggaaatacagaaaatccagagcaactcggagcgtttgcagtctcgtgtgaag
gagatccacgacagcaagtgtaagctggagcaggacctgagagagcaggtgtctgataac
agagagattgacaagaagatgaacagcctcaagccagatctcatgcagcttcgcaagatc
agggaccagtacttaatatggttgacgcagaaggggacgaggcagaagaagatcaatgaa
tggctgggtataaagaacgatgctgatgactctttctcactggaagaagatgagggctca
ccccaccatgacgagtgtacctggtacgtgggcgacatcaagcgcacccaggctgaggaa
atgctgagaggcaaatgcgatggaacctttctcatccgtgagagccagtcacagaagggc
tcttacgcctgctccgtagtcgtggacggtgactctaaacactgcgtcatctacaagaca
gtcacggggtatggattcgccgagccctacaatctgtattcgtccctcaaagacctggtg
ctccactacaaaaatgtctccttggtccaacacaacgaccagctgaatgtaaatctagcc
tacccagtcctggcccgctcccagaatcagaaccagcaccccagatga

KEGG   Maylandia zebra (zebra mbuna): 101487871
Entry
101487871         CDS       T02814                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00562  Inositol phosphate metabolism
mze01100  Metabolic pathways
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze05132  Salmonella infection
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101487871
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101487871
   04370 VEGF signaling pathway
    101487871
   04068 FoxO signaling pathway
    101487871
   04070 Phosphatidylinositol signaling system
    101487871
   04150 mTOR signaling pathway
    101487871
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101487871
  09143 Cell growth and death
   04210 Apoptosis
    101487871
   04218 Cellular senescence
    101487871
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101487871
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101487871
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101487871
   04625 C-type lectin receptor signaling pathway
    101487871
  09152 Endocrine system
   04910 Insulin signaling pathway
    101487871
   04914 Progesterone-mediated oocyte maturation
    101487871
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101487871
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101487871
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101487871
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101487871
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101487871
SSDB
Motif
Pfam: PI3Ka PI3K_rbd PI3_PI4_kinase PI3K_C2 PI3K_p85B C2 DUF2321 Ribosomal_S15
Other DBs
NCBI-GeneID: 101487871
NCBI-ProteinID: XP_024661530
LinkDB
Position
LG17
AA seq 930 aa
MPPRPSSGELWGIHLMPPRILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDSEVQDFRRNILNVCKDSVELRDASGPHSRALYVYPPNVESTQELPKH
IYSKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSPEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPISQYKYIRSCIMLGRMPNLMLMAKDSLYTQLPTD
NFVMPSYSRRISTATSYMNGEAAAKSLWTINGTLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQMCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNVNLFDYTHTLVANKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDHF
SSPVKYPDMNAVEDHANWTISRELGFNYNLSGQSNRVARDHALTESDTEQLRQLSNRDPL
SEITEQEKDFLWRHRHYCMNIPEILPKILLAVKWNSRDEVAQMYCLLKEWPSIRPEQAME
LLDCNYPDPMVRHFAVRCLDKYLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLEAYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMRFLVEQMKRPDYMDALQNFTSPLNPAHQLGNLRLDECRIMSSAKRPLW
LNWENPDIMSEMLFQNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLS
LGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSNTLHQWLKDKNKGEMYDMAVDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQVT
NT seq 2793 nt   +upstreamnt  +downstreamnt
atgcctcccaggccatcctcaggggagctatggggcatccacctgatgccccccaggatt
ctggtggactgccttctgcccaatgggatgattctgaccctggagtgtctccgtgaggcc
acgctcatcaccatcaaacatgagctgtttaaggaggcccgaaaatatcctctccatcac
ctcttacaggaagagacatcctacatcttcgtcagcgttacacaggaagcagagcgggag
gagttctatgatgaaacccggaggctgtgcgacctccgactctttcagcctttcctcaag
gtcattgaaccagttggcaacagagaggaaaagatcctcaacagagagattggtttcgcg
attggtatgcctgtgtgtgagtttgaccttgtgaaggactctgaggttcaggacttcagg
agaaacatcctgaatgtttgtaaagactctgtggagctgagagatgccagtgggccccac
agcagagcgctgtacgtttacccacctaatgtagagtcaacacaggaacttcccaaacac
atctatagcaaactggacaaaggtcaaattattgttgtaatatgggtgattgtttctcca
aataatgacaagcaaaagtacacactgaagatcaaccacgactgtgtgcctgaacaggtg
attgcagaggccattcgtaagaagacacgaagcatgctgctgtccccagagcagctaaag
atgtgtgttcaggaatatcagggtaaatacatcctcaaagtctgcggctgtgacgagtac
ctgctggaaaagtaccccatcagccagtacaagtatatccgtagttgcatcatgctgggc
aggatgcctaacctgatgctaatggctaaggacagcctgtacacccaattgcctacagat
aactttgtcatgccatcatattcccgacgcatctccacggcaacatcgtatatgaatggg
gaggcagctgccaagtctctgtggaccatcaacgggactctacgaatacgaatcctgtgt
gccacctatgttaacgtcaatatacgggacatagacaagatatatgtgaggacaggcatt
taccatggaggtgaacagatgtgtgacaatgtaaatacacagagggtaccctgctctaat
cccaggtggaatgagtggcttacgtatgatatgtacatcccagacatcccccgtgctgcc
agactctgcctttctatctgctctgtcaagggcagaaagggagccaaggaggagcattgt
ccactagcatggggtaatgtcaacttgtttgattatacacacacgctggtggccaacaag
atggctctgaatctctggcctgtcccccatggtcttgaagacctcctgaaccccatcgga
gtcactgggtcgaacccaaataaggaaacaccatgtctagagctggagtttgaccacttt
agtagtcctgtcaaatacccagacatgaatgcagtggaagatcacgcaaactggaccatc
tcaagggaactagggttcaactacaacctctcagggcagagcaatcgagtggccagagat
cacgccctcacagagagtgacaccgagcagttgagacagctgagtaacagagaccctctg
tcagaaatcactgagcaggagaaagactttctctggagacacaggcactactgcatgaac
atcccagagatccttcccaagatccttctcgcggtcaagtggaactccagagatgaagta
gcacagatgtactgtctgttgaaggagtggccgtctatccgtcctgagcaggccatggag
ttgctggactgtaactatccagaccccatggtcaggcactttgctgtacgttgccttgac
aaatacctgactgatgacaaattgtcccagtacttgatccagcttgtacaggttttaaaa
tacgagcagtatcttgacaatcccctggcccgttttctcctcaaaaaggccctgaccaat
cagagaataggacatttcttcttctggcatctcaagtcagaaatgcacaataaaacagtg
agccagaggtttgggctgctgttagaggcttactgccgtgcttgtggcatgtacctaaaa
cacctcagcaggcaagtagaggccatggagaagctcataaacctcaccgacatcctcaaa
caggagaagaaggatgagacgcagaaggttcagatgcggtttcttgtggaacagatgaag
aggccagactacatggatgccctgcagaactttacgtctcctctaaaccctgcgcatcaa
cttggaaacttgaggttagatgaatgcaggattatgtcgtcagcaaagaggcctttgtgg
ctgaactgggaaaatcccgacatcatgtctgagatgctctttcagaacaatgaaatcatc
ttcaaaaatggagatgacttgcgccaggacatgctgacattgcagattattaagatcatg
gagaacatttggcagaatcagggactggacctacggatgttgccctatggctgcttgtca
ttaggagattgcgtgggtctcattgaggtggttcgcaactcccacaccatcatgcagatt
cagtgtaaaggaggcttgaaaggggcactgcagttcaactcgaatactctgcatcagtgg
ctcaaggacaagaacaagggcgagatgtatgacatggctgtagatctgttcacaaggtct
tgtgctggctactgtgtagctacatttatccttgggataggagacaggcacaacagcaac
attatggtcaaagatgatggacaggtgacttga

DBGET integrated database retrieval system