KEGG   Maylandia zebra (zebra mbuna): 101463941
Entry
101463941         CDS       T02814                                 

Definition
(RefSeq) SHC-transforming protein 2 isoform X1
  KO
K17447  SHC-transforming protein 2
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101463941
   04370 VEGF signaling pathway
    101463941
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101463941
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101463941
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 101463941
NCBI-ProteinID: XP_004555056
LinkDB
Position
LG23
AA seq 726 aa
MLLKPKYDRFRNESVTSSDDLMQSLAMSGKVVATPVVPSSTPSLPLPPLPPLDPSARSSS
SAGAMALADSPCLDGEQDATTTFCMLIPKMPQWKFSNSLLSRSPSNSSSSSNSSKDSGKT
AAATSQASVTSSSSSHRPGGGASASGPVASLAAVLNSCDPVCVTPCSLQAIRGQRAVAAA
NSASPGGHVFGAAEVMASPGGSSNFRSGMTRSTRVEGMWLGGEDFNQKGSFIHKPSQGWL
HPDKKIVGQGASYIVRYMGCIEVLKSMRSLDFTTRTQVTREAINRLCEAVPGGKGAWRKK
VPNKALQSVMGKSNLRFAGMSIAVNISIDGINLLIPTTRQVIAHHPLQSISFASGGDTDT
PDYVAYVSKDPVNQRACHILECSDGLAQSVISTLGQAFELQFKQYLHSPPKTMTSVERSA
RTEEPIWRDDEDFSEPDYYNRIPGKEPPVGGVVDSRLRPSGTLIGHMHTQPQSKTAAQQM
SSPARRDQASHQPGQLCYELHWDTETTCSSGLTSDGYLCADGQPPGSRDYEEHQYVNTQS
LENLDSLTQGPDGHRGTRAPESPKKDLFDMRPFEDALKLHEACGVGSTISGGSGAEGGVG
GGRVLEDQWPSPPRRRAPVAPNEEQLRREPWYHSRMSRRDAEKLLSRDGDFLVRESTTNP
GQYVLSGLHRGLPKHLLLVDPEGVVRTKDMLFESITHLVSFHLKNELPIVAAESELHLKR
GVRRKQ
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgctccttaagccaaagtatgaccgctttcgcaatgagtctgtgacctcctccgacgac
ctaatgcagagcttagccatgagcggcaaagttgtggccacaccagtggttccctcctcc
acgccaagccttcctctgcctcctttgcctcccctggatcccagtgccaggtcctcctct
tctgctggggctatggccttggccgactctccttgcctggatggggaacaagatgccacg
acaaccttctgcatgctcattcctaagatgcctcagtggaaattctccaactccctgctt
agccggagtccatccaactccagttccagctccaattctagcaaggactcgggcaagaca
gcggcagctacttcccaggcctctgtcacgtcttcttcatcatcacacaggcctggtggt
ggagcctcagccagtggcccagtggcgagccttgcagcagtgcttaactcctgtgacccg
gtgtgtgtcactccttgttccctacaggccattcgggggcagcgagcagtagcagcggca
aattctgccagtccaggggggcacgtatttggagccgcagaggtcatggcgagccccggt
ggctccagcaacttcagatcgggaatgacgcgcagcacaagggtcgaaggcatgtggctt
gggggagaggacttcaaccagaagggcagcttcatccacaaaccctctcaaggctggctg
caccctgacaagaagatagtaggacaaggagcgtcctacattgtcaggtacatgggatgc
attgaggtgctgaaatcaatgcgatccctggacttcaccacacgcactcaagtgacaagg
gaagccatcaacagactgtgcgaagctgtgccaggtggaaagggggcttggaggaagaag
gttccaaacaaagctctgcagtcagtcatggggaagagtaacctacgatttgcaggcatg
agcatcgcagtcaatatttccatcgatggtattaatctgctcattcctaccacacgacag
gtgatagctcatcatcccttgcagtccatctcatttgcctctgggggagacacagacaca
cctgattatgttgcatatgtgtccaaagacccagtgaatcagagagcatgtcatatcctg
gagtgctcagatggtttagcccaaagtgtcatcagtaccctcggccaagccttcgagctg
cagttcaaacagtatctgcacagtccaccaaaaaccatgacatctgtggagaggtctgcc
aggacagaagaaccaatttggagggatgatgaggacttctctgagccggattactataac
cgtattccagggaaggagcctcctgttggaggtgtggtagactccagactcaggcccagt
ggaaccctcattggtcacatgcacactcaaccacagagcaagacagcagctcagcagatg
agctcaccagccaggagagatcaagcatctcaccagcctggtcagctgtgttatgagctt
cactgggacacggagacaacctgcagctcaggtctgacatcagatggttatttgtgtgct
gacggtcagcctccaggcagcagagactatgaggagcatcaatatgtcaacacccagagt
ctggaaaacctggattcactcactcagggtcctgatgggcacagaggcaccagggcacca
gagagtcccaaaaaggatctctttgacatgaggccctttgaggatgccctgaaactccat
gaggcctgtggtgttgggtccactatatctggaggctctggtgctgagggaggagtggga
ggtggtcgggtgttggaggatcagtggcccagccctccacgacgcagagcccccgttgct
ccaaatgaggagcagcttcgccgtgagccctggtaccacagccggatgagccggcgagac
gcagaaaaactcctgagccgggacggagattttctggtaagggagagcactaccaatcct
ggccagtatgtgctaagcggcctgcaccgtggcctccctaaacacttactgctagtggac
cctgaaggagtggtccggaccaaagacatgttatttgagagcataacccacctcgtctcg
tttcacctgaagaatgagctgcctattgtagcagcagagagtgagcttcatctcaaacgg
ggtgtgaggaggaagcagtga

KEGG   Maylandia zebra (zebra mbuna): 101471658
Entry
101471658         CDS       T02814                                 

Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101471658
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101471658
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101471658
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 101471658
NCBI-ProteinID: XP_004549677
LinkDB
Position
LG7
AA seq 657 aa
MLHRTKYNRFRNESVTSVDELLHGLTMNPKVSATPQSAAETSYTPPTEVQPSSATAPSSN
PTGHGSDHLEDGGTTLCTLINKVSGLKFSNSGSLLGIKGLPSAVKDLAVSKLQGGGGSGS
GCPSPSAAAASGAGVSLCSLASHSTPCSQLEPSVSMSKKSRLDEHQPSGEDWNPGGGGGL
VSKPSKGWLDSNEKISGPGVTYIVKYLGCIEVLRSMRSLDFTTRSQITREAISLVCEAVP
GTKGALRKRKPPSKALSSILGKSNLQFAGMSINLNISTSSLNLMTPDCKQIIANHHMQSI
SFASGGDPDTTDYVAYVAKDPVNRRACHILECSDGLAQNVISTIGQAFDLRFQQYLQCPS
SKLSSTHDRVLNMEELPWTEEEEESAEHPYYNNIPGKMPPPGGFIDTRLTNQNADGCQMG
TGSVDQTYYQGRQSWGDERKTFFMQQGSFDISGLPETKGQAPNAEEMPTYVNTQQIDAQV
LAALQAEAENVTKGMAAAAKESPQKDLFDMKPFEDAIQSQSQSQGQSQVSGLHKAASVDN
SSPLLVRSLAFRAQEELEGQMWYHGKMSRRDAEKLLKNDGDFLVRKSTTNPGSYVLTGMH
NGIAKHLLLVDPEGTVRTKDHIFDSISHLIGHHRDNNLPIVSAGSELCLLQPVGRKQ
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgcttcaccgtaccaaatacaaccgcttcagaaatgagtcagtaacatccgtcgatgag
cttcttcacggcctgaccatgaaccccaaggtctcggccaccccccagtctgcagccgag
acgtcttacacacccccgactgaggttcagccctcctccgccaccgctccttccagcaac
cccaccggccatggctctgaccacctggaagatggaggcaccaccctctgtacgctcatc
aacaaggtgtccggcctgaaattcagcaactccggcagcttgctcggcataaagggtctg
ccctcggccgttaaggacctggctgtgtcaaagctgcaggggggtgggggatcaggctca
ggctgcccgagtcccagcgcagcggcagcctctggtgcgggtgtctctctgtgcagtttg
gcctcccattcaaccccctgttcacagctggagccatctgtcagcatgagcaagaagagc
aggctggatgagcaccagcccagcggagaggactggaatccaggtggaggcggtggactg
gtgagcaaaccctccaaaggatggctagactcaaacgagaagatctctggtcccggagtc
acatacattgttaagtatctgggctgtatagaagtcctgaggtcgatgagatccctggat
ttcactacaaggtcacaaataacaagggaagccatcagcctggtgtgtgaggctgttcca
gggaccaaaggagctctgcggaagagaaagccaccatccaaagctctgtccagtattttg
gggaagagcaatctgcagtttgccggcatgtccatcaacctcaacatctccacaagtagc
ctcaacctgatgacccctgactgcaaacagattatagccaaccatcacatgcagtccatt
tcctttgcatcaggtggagaccctgatacaacagattatgttgcctatgtagcaaaggac
ccagttaacagaagagcgtgccacatcttggagtgctctgatggactagcccagaacgtc
atcagtaccatcggccaggcctttgaccttcgcttccagcagtacctgcagtgtccctca
agcaagctgtcgtccacacatgacagggtattaaacatggaggagttaccttggacggag
gaagaggaggagtcagcagagcacccttactataacaacatccccgggaagatgcctccc
cctggaggcttcattgacaccaggctgaccaatcaaaatgcagatggttgccagatgggt
acaggatctgtcgatcagacatattaccaagggcggcaaagctggggagatgaaagaaag
actttcttcatgcaacagggatcatttgatataagtggactcccagagactaaaggtcaa
gcaccaaatgcagaagaaatgcccacctatgtgaacacccagcagatcgatgcccaggtg
ctcgcagctctccaggcagaggctgaaaatgtgacaaagggcatggcagctgcagccaaa
gagagcccacagaaggacctgtttgatatgaagcccttcgaagatgcaatccagtcccag
tcccagtctcagggacagtcccaggtatccggtcttcacaaggcagcatccgtggacaac
tcgagccctctgcttgtgcgctctctggccttccgggctcaggaggagctggagggccaa
atgtggtaccacggtaaaatgagtcgccgcgatgctgaaaaacttctgaaaaatgacggg
gactttctcgtccgtaagagcactaccaacccagggtcctacgtactgacaggcatgcac
aatggaattgccaaacacctgctgctggtggaccctgaaggcacggtacggacaaaagat
cacatatttgacagcattagccaccttattggccatcaccgtgacaacaacctgccgatt
gtttcagccgggagtgaactgtgtctcctacagcctgtgggaaggaaacagtga

KEGG   Maylandia zebra (zebra mbuna): 101474172
Entry
101474172         CDS       T02814                                 

Gene name
shc4
Definition
(RefSeq) SHC-transforming protein 4 isoform X1
  KO
K17449  SHC-transforming protein 4
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101474172 (shc4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101474172 (shc4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101474172 (shc4)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 101474172
NCBI-ProteinID: XP_004543553
LinkDB
Position
LG1
AA seq 588 aa
MREQTLSRLKSQTGLLPGMLKRTKYSRLRNDSPTSLEENPQGMLPLKQDLCLDSEFSQLG
LGISTHHGPSTLRDFIPRMANIRLQSPISRQGLKGQTDTARGRSISAPTDKPLSRTEWGS
GSNERFCTHASLNAPLSTGQNLIHPALLCTKRPITLQRMASLPWTPGYPPCSHHRGGLCC
VKISSAKGDRTVVGTGSRAVHHHIKYMGSVEVTQSMRTLDFDTRMQVTREAISRLCARTL
LKTAVKTKRPVCKGLSSVLGQTNLQFSGRRIILTVSTDSMTLIAASSLQKIAHHPMQTIS
FASGGDSDMADYIAYVAKDLANDRACHILECPEGQANEVINSIGQAFETRFRHLLSQTPS
VLSTSSRPALRICHKWCPEELIINQKANREGEFSEHRDYYNVNPGDPGGIKDFQVTEEES
KEDANIHRVCFPRPVSLYENCSITDETPAPPADLEQSEINTEQRSLLTETRVQKLIQEEG
WFHGRLGREQAESLLTCSGDFLVRESSSAAGQYVLSGMEGATVRHLLLVDPHGQVRTRDQ
VFLSVGHLVRFHMENQMPIVAGSSELCLKQPILQTHKHSQTARCMVLN
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgagagagcaaaccttatccaggttgaaatcacagacgggactcctaccaggtatgctg
aagcgtactaaatacagtcgactgcgcaacgattctccaacatctctggaggagaacccc
cagggaatgttgcccctgaagcaggacctctgcttagactctgaattcagtcagctggga
cttgggatttctacacaccacggaccatccaccctgagggatttcatcccccgcatggcc
aacatccgactgcaaagccctatttcccggcaaggcctaaaaggacagacagacacagcc
agaggcagaagcatcagtgcccctactgacaaacccttgtccagaacagagtggggttca
ggaagtaatgagagattttgcactcacgcttccctcaacgctcccctatccacgggccaa
aatctaattcaccctgctttgctctgcacaaaaagacctatcaccctacaacggatggca
agccttccttggacccctggatatcctccctgctcacatcacagaggtggtctgtgctgt
gtgaagatttcctctgcaaaaggtgatcgtacagtggtggggacaggaagcagagcagtt
caccatcacatcaagtacatgggtagtgtggaagtgacccagtccatgagaacccttgac
tttgatacaagaatgcaagttacacgagaggcaatcagcagactttgtgcgaggacattg
ctcaaaacagcagtgaaaactaaaaggcctgtttgcaagggactgtcttctgttctgggt
cagacaaacctgcagttttctggaagaaggatcatcctcactgtctccaccgacagtatg
actctaatcgctgcctcgtccttacagaagattgcccaccaccccatgcagaccatttca
tttgcctccggtggagattcagacatggcagattacattgcttatgtagctaaagacctt
gccaatgacagagcctgtcacatcctggagtgtcccgagggtcaagccaatgaggttatc
aacagcatcggtcaggcctttgagacgcgcttccgccaccttctcagccagacaccatcg
gtcctgtccaccagttccagaccggcactgagaatctgtcacaaatggtgcccagaagag
ttaataataaaccaaaaggcaaaccgggaaggagaattcagtgaacaccgtgactattac
aatgtgaacccaggagacccaggtggaataaaagactttcaggtcacagaagaggagagc
aaagaagatgctaacattcacagggtctgtttccctcggcctgtttccctttatgagaac
tgctccatcacagatgagactccagctccacctgcagatttagagcagtctgagatcaat
actgaacaacgctctctgctcactgagacgcgggtccagaagctgatccaggaagaagga
tggttccacggcaggttgggaagagagcaggcggagtcgcttctcacctgtagcggagat
ttcctggtcagagagagcagctctgccgctggtcagtatgtactcagcggtatggaggga
gctactgtgcgacacctactgctggttgatccacatggacaggtgcggacccgtgatcag
gtgtttctgagcgttggccacctggtgcgattccacatggagaatcagatgcccattgtt
gctggaagcagcgagctgtgcctgaaacagccgatcctgcaaacacacaaacattcacag
actgccagatgcatggtcttgaattag

KEGG   Maylandia zebra (zebra mbuna): 101480827
Entry
101480827         CDS       T02814                                 

Gene name
shc1
Definition
(RefSeq) SHC-transforming protein 1 isoform X1
  KO
K06279  SHC-transforming protein 1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101480827 (shc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101480827 (shc1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101480827 (shc1)
SSDB
Motif
Pfam: PID SH2 PGM_PMM_IV
Other DBs
NCBI-GeneID: 101480827
NCBI-ProteinID: XP_004541335
LinkDB
Position
Unknown
AA seq 600 aa
MIQFIMEKTKYTHFRSESLSSTDETNSNPSSFPPSSPVTPLTPSPGLPSSLSSSSLTPIL
PPSSPQQAENSPTTFCSFFPRMGSLRLGVSATLLPGLKASSKSQGAQAPQAPVESSGDDR
SNSSSSPPLHHPVSLLTAPSPPPRPPLQDMNRLGGVSRRARVEGGQLGGDEWTRHGSFVN
KPTRGWLHSDNVVSTTGVSYSVRYMGCVEVLQSMRALDFNTRTQVTREAISVVCEAVPGA
KGARRRKPSSRCLTSILGKSNLQFAGMTISLTISTSSLNLLASDCKQIIANHHMQSISFA
SGGDPDTAEYVAYVAKDPVNQRACHILECSEGLAQEVISTIGQAFELRFKQYLKNPPKLV
TPHDRMAPFDGSAWEEEEDEAAPPPDVPYYNNFPGKQPPPAGVIDMRTRPGATLPYGQPG
QNDIHKQPLPPLPVGAKEGGREMFDDPSYVNVDKPRLPAAANGNAHKDAFDMKPLDDALG
VSGHGGPNSVTAVPSMVQQLQSEIWFHGSLSRKEAEKLLTRDGDFLVRESGTTPGQYVLT
GQQGGQPKHLLLVDPEGVVRTKDHRFSSVSHLISYHMDNRLPIVSAGSEVCLQQPVERRA
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgattcaattcattatggagaaaacaaaatacacccattttcggagtgaatcactgagc
tcaactgacgaaacaaactccaatccatcatcgtttcctccttccagtcctgtcaccccc
ctcacaccctcccctggcttaccttcctctctctcttcctcatctctcactcccattttg
cccccctcctctccccaacaagctgagaacagccccaccaccttctgctccttcttcccc
agaatgggctctcttcgtctgggtgtctcagctactcttctcccaggactcaaggcctca
agcaaatcacagggagctcaggcacctcaggcacctgttgagtcctctggggatgacagg
agcaactctagctcctccccaccacttcatcaccctgtttcgcttctaactgctccttct
ccccctccccgacctcctctgcaggacatgaaccggctaggaggggtgtctaggagggca
cgggtggaaggagggcagctgggaggagacgagtggacgcgccatggctcctttgtcaac
aagcccacccgtggctggctgcactcagacaatgtggtcagcaccactggtgtttcctac
agtgtacggtacatgggatgcgtggaggtgctacaatcaatgcgggcgctggacttcaac
accagaactcaggtcaccagggaagctatctctgtggtgtgtgaggcagtacccggtgcc
aaaggagcccgcaggagaaagccttcttctcgctgtctaacgtccatcctgggaaagagt
aatttacagtttgcaggcatgacaatcagcctcaccatctcgaccagcagcctcaatctg
ctggcctctgactgcaaacagataatcgccaatcatcacatgcagtccatctctttcgcc
tctggaggagacccagatacagctgagtacgtagcatatgtggccaaagatccagtcaac
cagagagcatgtcatatcctggagtgttcggagggtttagcccaggaagtcatcagcacc
attggtcaggccttcgaactgcgttttaaacagtatctgaaaaaccctccgaaactggtc
acacctcatgacagaatggctccatttgatggctctgcatgggaggaagaagaagatgag
gctgctccgcctcctgatgtcccgtactataataatttccctggaaaacagcctccccct
gctggagtgattgacatgaggacccggcctggtgccacgctgccttatggacagccgggt
cagaatgacattcataaacagcctctgccacccctaccagtgggtgccaaagaaggtggg
cgggagatgtttgatgacccttcgtacgtcaacgtagataaacctcgcctcccagctgca
gcaaacggaaatgctcacaaagacgctttcgacatgaagccactggatgatgccctgggg
gtttctgggcatggaggcccaaactcagtgacagcagtgccctctatggtgcagcaatta
cagtctgaaatctggttccacgggagcctaagtcgtaaggaagcagagaaactgttgacc
cgagatggagacttcctggtgcgggagtctggaaccacacctgggcagtacgtcctcacg
ggacagcagggtggtcagcccaaacacctgctgctcgttgacccagaaggagtggtccgt
acaaaagaccaccggttttcgagtgtcagccacctgatcagttaccacatggacaacaga
cttcccattgtgtcagctgggagtgaagtgtgtctgcaacagccagtagagcgcagggcc
tga

DBGET integrated database retrieval system