KEGG   Maylandia zebra (zebra mbuna): 101464257
Entry
101464257         CDS       T02814                                 

Gene name
prkca
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04150  mTOR signaling pathway
mze04261  Adrenergic signaling in cardiomyocytes
mze04270  Vascular smooth muscle contraction
mze04310  Wnt signaling pathway
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101464257 (prkca)
   04012 ErbB signaling pathway
    101464257 (prkca)
   04310 Wnt signaling pathway
    101464257 (prkca)
   04370 VEGF signaling pathway
    101464257 (prkca)
   04020 Calcium signaling pathway
    101464257 (prkca)
   04070 Phosphatidylinositol signaling system
    101464257 (prkca)
   04150 mTOR signaling pathway
    101464257 (prkca)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101464257 (prkca)
   04540 Gap junction
    101464257 (prkca)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101464257 (prkca)
   04916 Melanogenesis
    101464257 (prkca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101464257 (prkca)
   04270 Vascular smooth muscle contraction
    101464257 (prkca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101464257 (prkca)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101464257 (prkca)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101464257 (prkca)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101464257 (prkca)
Membrane trafficking [BR:mze04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101464257 (prkca)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like
Other DBs
NCBI-GeneID: 101464257
NCBI-ProteinID: XP_004539264
UniProt: A0A3P9AXE9
LinkDB
Position
LG6
AA seq 681 aa
MADVSLNESSSADVANRFARKGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGK
QGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRTKHKFKIHTYGSPTFCDHCGSLL
YGLIHQGMKCDSCDMNVHNQCVMNVPSLCGTDYTERRGRVFLKCEVSGDKLQVTVTEARN
LIPMDPNGLSDPYVKLKIVPDPKNETKQKTKTIRSSLNPKWNETFTFKLRNTDKDRRLSV
EVWDWDRTTRNDFMGALSFGVSELMKAPVCGWYKLLCQEEGEYYNVPISEEDDGNEELRQ
KFEDQAVVEDSDQKAKLGPTKKVITETDDSHSSQLPSNSLNQVKLIDFNFLAVLGKGSFG
KVMLAEMKTTEELYAIKILKKDVVIQDDDVECTMVEKRVLAQQDKPPFLTYLHSCFQTVD
RLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHCKGIIYRDLKLDNVML
DSEGHIKIADFGMCKENMTEGVSTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEM
LAGQPPFDGEDEDELFQSIMEHNVSYPKSMSKEAVSICKGLMTKHPSKRLGCGAEGERDI
REHAFFRRIDWERLENREIQPPFKPKVCGKGAENFDKFFTRTQPQLTPPDELVIANIDQA
EFAGFSFINPQFVHPSLNNSE
NT seq 2046 nt   +upstreamnt  +downstreamnt
atggctgatgtaagtttgaacgagtcgtcctccgcggacgtcgcaaataggtttgctcgg
aaaggtgccctgaggcaaaagaacgtccacgaggtcaagaaccataaattcatagccagg
ttcttcaagcagccgactttctgcagccactgcacggacttcatctgggggtttggaaaa
caaggattccagtgccaagtttgctgttttgtggtccacaagagatgccatgaatttgtc
acgttctcctgcccaggggcagataaggggcccgatacagatgatcccagaactaagcac
aagttcaagatccacacctatgggagccccaccttctgcgatcactgtggctctctgctc
tacggcctcattcaccagggcatgaagtgcgactcctgcgatatgaatgtccataatcag
tgtgttatgaatgtgcccagcctgtgtggaactgattacactgaaaggagggggcgtgtt
tttctcaagtgtgaggtcagcggagataaactgcaggtcacagtgactgaagccagaaac
ctcattcccatggaccccaacgggctgtctgatccatatgtgaagctcaagatcgtacca
gatcccaaaaatgagaccaagcagaagaccaaaacgatccgctccagcctcaaccccaaa
tggaacgagacgttcactttcaagctgaggaatacagataaagaccgcagactatcagta
gaagtgtgggactgggatcggaccacgaggaatgacttcatgggagccctttcctttggc
gtgtcagagctcatgaaggctccagtctgtggatggtataagttattgtgccaggaggag
ggggagtactacaatgttcccatctcagaggaggatgatggtaatgaggaactgaggcag
aaatttgaggaccaagcagttgtggaagactctgatcagaaagccaaacttggtcccact
aagaaggtgatcactgagactgatgacagccactccagccagctcccatcaaacagcctg
aaccaggtcaaactcatcgacttcaatttcctagctgtgttggggaagggaagctttggc
aaggtgatgctagcagagatgaagaccactgaggagctgtatgctataaagattctgaag
aaggatgtggtaatccaggatgatgatgttgaatgtaccatggtggagaagagagtcctg
gcccagcaggacaaaccgcccttcctcacatacctccactcgtgcttccagacagtggac
cgcctgtactttgtcatggagtatgtgaatggtggagaccttatgtaccatatccagcaa
gtgggcaagttcaaggaacctcaggcagtgttctatgcagcagagatcgctgttggtctc
ttcttcctgcactgtaaaggaatcatttacagggatctgaagttggacaacgtgatgctg
gactctgagggacacattaagattgctgactttggcatgtgtaaagagaacatgacagaa
ggagtcagcacgaggaccttctgtggcactccagactacatagctccagaaatcatagca
tatcagccatacggtcgctctgtagactggtgggcatatggagttctgctctatgaaatg
cttgcaggacagcctccatttgatggtgaagatgaggatgagttgttccagtccattatg
gagcacaatgtgtcctaccccaagtcgatgtccaaagaagctgtctctatctgcaaaggg
ttgatgactaaacacccatccaaacgtctgggctgtggcgctgagggagagagggacatc
agagaacacgccttcttcagacgcatcgattgggaacgtctcgagaacagagagatacag
cccccctttaagcctaaagtgtgcggcaaaggagcagagaactttgacaagttcttcaca
cgcacccagccccagctcacaccgccagatgagctggttattgccaacattgaccaggcc
gagttcgcagggttctctttcatcaacccccagtttgtacacccgtcgctcaacaacagc
gaatga

KEGG   Maylandia zebra (zebra mbuna): 101465488
Entry
101465488         CDS       T02814                                 

Gene name
prkcb
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04150  mTOR signaling pathway
mze04270  Vascular smooth muscle contraction
mze04310  Wnt signaling pathway
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101465488 (prkcb)
   04012 ErbB signaling pathway
    101465488 (prkcb)
   04310 Wnt signaling pathway
    101465488 (prkcb)
   04370 VEGF signaling pathway
    101465488 (prkcb)
   04020 Calcium signaling pathway
    101465488 (prkcb)
   04070 Phosphatidylinositol signaling system
    101465488 (prkcb)
   04150 mTOR signaling pathway
    101465488 (prkcb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101465488 (prkcb)
   04540 Gap junction
    101465488 (prkcb)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101465488 (prkcb)
   04916 Melanogenesis
    101465488 (prkcb)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101465488 (prkcb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101465488 (prkcb)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101465488 (prkcb)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101465488 (prkcb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C CBX7_C C1_2 CEP76-C2 Kinase-like
Other DBs
NCBI-GeneID: 101465488
NCBI-ProteinID: XP_024657935
LinkDB
Position
LG4
AA seq 680 aa
MADSAAANSDGEDGPREPMRGFARQGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIW
GFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHC
GSLLYGLIHQGMRCDHCMMNIHKRCVANVPSLCGTDHTERRGRIQITAEVKTNVLTVTIK
EARNLVPMDPNGLSDPYVKLKLIPDPRSESKQKTKTIKCCLNPTWNETFKFHLKEYDKDR
RLSVEMWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGN
EELRQKFERAKIGPGKNTEGKSANAASRFDSNGNQDRMKLSDFNFLMVLGKGSFGKVMLA
ERKGTEDLYAVKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSTFQTMDRLYFV
MEYINGGDLMYQIQQVGKFKEPHAVFYAAEIAIGLFFLHQKGIIYRDLKLDNVMLDCEGH
IKIADFGMCKENMNDGITTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQP
PFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPAKRLGCGPEGERDIREHSF
FRYMDWEKLENKEVQPPFKPRACGRDAENFDRFFTRHPPVLTPPDEEVIQNLDQDEFQGF
SFINPEFTGNAAATTATEQA
NT seq 2043 nt   +upstreamnt  +downstreamnt
atggcagactcggcggcggccaacagtgatggggaggacggaccccgcgagcctatgcgg
ggcttcgcgcgccagggagctctccggcagaagaacgtgcacgaggtgaaggaccacaaa
ttcatcgcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgg
ggttttgggaagcagggatttcagtgtcaagtgtgttgtttcgtggttcacaaacgttgc
catgagttcgtcactttctcctgcccaggtgctgataaagggcccgcgtcagacgacccg
aggtcaaagcacaagtttaagatccacacctactccagccccaccttctgtgaccactgt
ggctccctactctatggcctcatacaccagggaatgagatgtgaccactgtatgatgaac
atccataagcgatgtgtggccaacgtgccgagcctgtgtggcacagaccacactgagagg
agaggtcgcatccagatcaccgccgaggttaagaccaatgttctcactgttaccatcaaa
gaggccaggaatctggttcccatggaccccaacggtctgtcagacccttatgtgaagctt
aaactgatcccggatccccgcagcgagagtaaacagaagaccaagaccataaagtgctgc
ctcaaccccacctggaacgagacctttaaattccacctgaaagaatacgataaggaccgc
cgtctgtcagtggagatgtgggactgggacctgaccagccgcaatgacttcatgggatca
ctgtcctttggcatctcggagctccagaaacaaggggtggatggatggtttaagctgctc
tcccaggaagaaggcgagtacttcaatgtacccgtccctccggagggggaggagggcaac
gaggagctacggcagaaatttgagagggctaaaattggtccggggaagaacacagaaggg
aagtcagccaacgccgcatcccggttcgactccaatggcaaccaagaccgcatgaagttg
tctgactttaacttcctcatggtgctgggcaagggcagctttggcaaggtgatgctggca
gagcgcaaaggaaccgaggacttgtacgctgtaaagatcctgaagaaggacgtcgtgatc
caagatgatgacgtagagtgcaccatggtggagaagagagtgctagctttatctggaaag
cccccgttcttaacacagctgcactctaccttccagactatggaccgtttgtattttgtc
atggagtacataaacggcggagatctcatgtatcagatacagcaggtcggcaagttcaaa
gaacctcacgctgtattctacgctgcagagatagcgattggtctgtttttcctacatcaa
aagggcatcatctacagagacctgaagctggacaatgtaatgctggactgtgagggccac
attaaaatagcagactttggcatgtgtaaagagaatatgaatgatggaatcacaaccaag
accttctgtggcacaccggattacattgctcctgagattatagcctaccagccttacggg
aaatctgtggactggtgggcctttggcgtcttgctctacgagatgctggctggacagcct
ccatttgacggagaggatgaagatgagttatttcagtcaatcatggagcaccacgtctcc
tatcccaagtcaatgtccaaggaggctgtcgctatctgtaaagggctgatgacaaagcat
ccagcgaaacgcctgggctgtggtccagagggggagagagacatcagagagcacagcttc
ttccgctacatggactgggagaaactggagaacaaggaggtgcaaccacccttcaaaccg
agagcctgtggacgagatgccgaaaactttgaccgttttttcacacgccacccgccagtg
ctgacccctccagatgaggaagtgattcagaatctggaccaagacgagttccagggattc
tcctttatcaacccagagttcacaggaaatgctgctgccaccactgccaccgagcaggct
tga

KEGG   Maylandia zebra (zebra mbuna): 101478005
Entry
101478005         CDS       T02814                                 

Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04150  mTOR signaling pathway
mze04270  Vascular smooth muscle contraction
mze04310  Wnt signaling pathway
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101478005
   04012 ErbB signaling pathway
    101478005
   04310 Wnt signaling pathway
    101478005
   04370 VEGF signaling pathway
    101478005
   04020 Calcium signaling pathway
    101478005
   04070 Phosphatidylinositol signaling system
    101478005
   04150 mTOR signaling pathway
    101478005
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101478005
   04540 Gap junction
    101478005
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101478005
   04916 Melanogenesis
    101478005
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101478005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101478005
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101478005
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101478005
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 101478005
NCBI-ProteinID: XP_004568408
UniProt: A0A3P9BZH6
LinkDB
Position
LG6
AA seq 667 aa
MADPNSEGEVPESARGFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGKQ
GFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFRVHTYSSPTFCDHCGSLLY
GLIHQGMKCDHCMMNIHKRCVANVPSLCGTDHTERRGRIHISAQITDDTLTVTIKEAKNL
VPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPTWNETFTFNLKETDKDRRLSVE
VWDWDLTSRNDFMGSLSFGISELQKQGIDGWFKMLSQEEGEYFNVPVQPDGEDGNEELRQ
KFERARVGPGKPTDSSSSSSVCKYDSNGNQDRVKLSDFNFIMVLGKGSFGKVMLAERKGT
DELYAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYIN
GGDLMYHIQQVGKFKEPHAVFYAAEIAIGLFFLHSKGIVYRDLKLDNVMLDSEGHIKIAD
FGMCKENMLDGITTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGE
DEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPAKRLGCGPEGERDIKEHAFFRYID
WEKLENKEVQPPFKPKACGRDAENFDRFFTRHPPELTPPDQDVIVNLDQQEFQGFSFVNP
EYSYTDH
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggctgaccccaacagcgaaggagaggtgccggagagcgcgcgcggctttgcccgtcag
ggagccctccgtcagaagaatgtgcacgaggtgaagaaccacaagttcatcgcgcgcttc
ttcaagcagccaaccttctgcagccactgcacggacttcatctggggctttgggaagcag
ggattccagtgccaagtgtgctgttttgtggtccataagcgctgtcatgaatttgtcacc
ttctcctgtccgggggccgacaaaggacctgcctccgatgatcctcgtagtaaacacaag
tttagggtccacacttactcaagccccaccttctgtgaccactgtggctccctcctgtac
gggctgatacaccagggaatgaaatgtgaccactgtatgatgaacatccacaagcgatgt
gtcgccaacgtcccgagcctgtgcgggacggatcacacggaaaggcgaggacgcatccac
atctctgcgcagatcactgacgacactctcaccgtcaccatcaaagaggctaagaacctg
gtgcctatggatcccaacggcctgtcagacccctacgtcaagctcaagctgattcccgat
cccaagagtgagagcaagcagaagacaaagaccatcaaatgctccctcaaccccacgtgg
aacgagaccttcactttcaacctcaaagaaactgacaaggaccgccgtctgtcagtagag
gtctgggactgggatttgaccagcaggaatgacttcatgggatcactgtcctttgggatc
tcagagctacagaaacaagggatagatggatggtttaagatgctgtcccaggaggaagga
gaatactttaatgttcctgtccagccagatggagaggatggtaatgaggagctacggcaa
aagtttgagagagcgagagtgggtccagggaagcccactgactcctcttcttcctcctcg
gtgtgcaagtacgacagcaacggcaatcaggaccgcgtcaagctctcagatttcaacttc
atcatggttctgggcaagggcagcttcggcaaggtgatgctggctgagaggaaaggcaca
gatgagttgtacgccatcaaaatcctgaaaaaagacgtggtgatccaagatgatgacgtg
gagtgcaccatggtggagaagagagtcctcgccctgtcaggaaaaccacctttcctcact
cagctgcactcatgcttccaaaccatggaccgattgtattttgtcatggagtatattaat
ggaggagaccttatgtaccatatccaacaggtcggcaagtttaaggagcctcatgctgtg
ttctatgctgctgagattgccatcggcctgttcttccttcattccaagggcattgtgtat
cgggatctgaagctggacaatgtgatgctggactctgagggccatataaagattgcagat
tttggaatgtgtaaagaaaacatgcttgatggcattaccacaaagactttttgtggaact
ccagactacatcgctccagagatcatagcctatcagccttatgggaagtctgtggactgg
tgggcttttggagtcctgctttatgaaatgcttgctggacagccgcctttcgatggtgaa
gatgaagatgagcttttccagtccatcatggagcatcacgtctcataccctaaatccatg
tccaaagaagcagttgctatctgcaaggggctgatgaccaaacacccggctaagcgtctg
ggctgcggcccagaaggtgagagagacatcaaggagcacgccttcttccgctacatagac
tgggaaaaactggagaataaggaagtccagccgcctttcaaaccgaaagcttgtgggcgt
gatgcggagaactttgaccgctttttcacacgccatcccccagagctgacccccccagat
caggacgttatagtcaacctggaccagcaagaattccaaggcttctcatttgttaaccct
gagtactcctacacagatcactga

KEGG   Maylandia zebra (zebra mbuna): 101481445
Entry
101481445         CDS       T02814                                 

Definition
(RefSeq) protein kinase C alpha type-like
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04150  mTOR signaling pathway
mze04270  Vascular smooth muscle contraction
mze04310  Wnt signaling pathway
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101481445
   04012 ErbB signaling pathway
    101481445
   04310 Wnt signaling pathway
    101481445
   04370 VEGF signaling pathway
    101481445
   04020 Calcium signaling pathway
    101481445
   04070 Phosphatidylinositol signaling system
    101481445
   04150 mTOR signaling pathway
    101481445
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101481445
   04540 Gap junction
    101481445
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101481445
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101481445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101481445
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101481445
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101481445
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like APH
Other DBs
NCBI-GeneID: 101481445
NCBI-ProteinID: XP_004550764
LinkDB
Position
LG11
AA seq 704 aa
MSTPVSPSPSLSPLTLASPTSATSPSASPLPSPLSPPPRVPVFQRKGALKHKRIVEVKDH
QFTARFFKQPTFCSHCTDFIWGIGKQGFQCQVCSFVVHKRCHEFVTFTCPGSVTAPRPDD
LKSRHTFKIHTYSSPTFCDHCGSLLYGLIHQGMKCTSCDMNVHRRCETSVPSLCGQDHTE
KRGRIHLTIRGEKEDVFVTVREARNLMPMDPNGLSDPYVKLKLIPDPKSHSKQKTKTIRS
TLNPVWNESFTFSVRGHQWDRRLSVEIWDWDRTSRNDFMGALSFGVSEIFRRPISGWFKL
LAQDEGEYYNIPVPDPDLQEPQPDATTPSLPQAMPSPLSEPFPVALSPTLIPSCPPVHTP
GPGKVKMGIHDFNFLMVLGKGSFGKVLLAEERGSERLFAIKVLKKDVLFQDEDTESALVE
RRVLALLSRPHFLTSLYCAFQTEDRLYYVMEYVNGGDLMFHIQIVGKFKEPHAAFYAAEI
AVGLFFLHSKGIIYRDLKLDNVLLDSEGHIKIADFGMCREGMFEGDTTRTFCGTPDYIAP
EIVAYQPYNKAVDWWSYGVLLYEMLAGQPPFDGIDEEELFQSIMEQSVSYPKSLSWEAVA
ICKGLLTKHPAKRLGEGEDAEREIREHPFFRWIDWDRLERLEIPPPFKPRTGGKKGENFD
KFFTAAQTALTPSDPDILAAMNQEDFEGFSFINPDFAPSPLTAV
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgtctaccccagtctccccgtccccctcgctctccccactgacactggcctcccctaca
tctgcaacctcccccagtgcctcccctctgccctcgcctctctcccctccacccagggtg
cccgtgtttcagaggaagggagcgctcaaacacaaaaggattgtcgaagtgaaagaccac
cagtttacagcacgcttcttcaaacagcccaccttctgcagtcattgcaccgacttcata
tggggcattgggaaacagggattccaatgtcaagtttgcagttttgtggtccacaaaaga
tgtcacgagtttgtgaccttcacgtgccccggctctgtgaccgcccccagaccagatgac
ctgaagagtcgacacacatttaagatccacacgtactccagccctacattttgtgaccac
tgtggctcgttgctgtatggcctcatacaccagggcatgaaatgtaccagctgtgacatg
aacgtccatcggcgatgcgagaccagcgtccccagtctgtgtggccaggatcacacagag
aagagagggagaatccatctgaccatcagaggagaaaaggaggacgtctttgtcacagtg
cgggaggctcgtaacttgatgcccatggacccaaatggcttgtcagacccgtatgttaaa
ctgaaattgattccagacccaaagagccacagcaaacagaagactaagaccatccgctca
acactcaatcccgtctggaatgagagcttcaccttctccgtgcgtggtcaccagtgggac
aggcgtctgtctgtggagatatgggactgggaccggacgtctaggaacgatttcatggga
gcgctgtcgtttggcgtgagtgagatcttcaggcgtccaatcagtggttggttcaaactg
ctggcccaagatgagggagagtactacaacattcctgtgccagacccggacctgcaggag
cctcagccagatgctactacaccttctttgcctcaagcgatgccttccccgctgtctgaa
ccatttcccgtggccctgtccccgaccctcattccctcctgtccccctgtccacactccg
ggccctggcaaagttaaaatgggcatccacgatttcaacttcctcatggttcttggaaaa
ggcagctttggcaaggtgctgctggcagaggagcgaggcagcgagcgtctgtttgccata
aaagtgctgaagaaagacgttctcttccaggacgaggacacggagagcgctctagtagag
aggagggttctggcgctcctttctcgtcctcacttcctcacgtccctctactgcgccttc
cagactgaggaccgactgtattacgtgatggaatatgtcaacggaggagacctgatgttt
cacattcagatagttgggaagttcaaagagcctcacgcagcgttttatgcggcagagata
gcggtcggcctcttcttcctccacagcaaaggcatcatctacagggatctaaagctggat
aatgtgctgctcgacagcgagggccacataaagatagcagactttgggatgtgcagggag
ggcatgttcgagggcgacaccacacgtaccttctgcggcactcctgactacatcgcccct
gagattgtggcctatcagccctataataaagcagtggactggtggtcttatggagtgctg
ctgtatgaaatgctggcaggacagccgccatttgatggcattgacgaggaggagctgttt
cagtccatcatggagcagagtgtctcatacccaaaaagtctctcttgggaggctgtagct
atctgcaagggactcctgacaaagcacccggccaagcgcctgggtgaaggagaagatgca
gagagggagatcagagagcatccgttcttccgctggattgactgggaccgtctggagaga
ctggaaatcccgccacctttcaaacccagaactggtgggaaaaaaggtgagaactttgac
aagttcttcacagctgctcaaacggcgctcaccccctcggacccggatatactcgcagcc
atgaaccaggaagacttcgaaggcttctccttcatcaacccagactttgctccgtcaccg
ctcaccgctgtttga

KEGG   Maylandia zebra (zebra mbuna): 101487097
Entry
101487097         CDS       T02814                                 

Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04150  mTOR signaling pathway
mze04261  Adrenergic signaling in cardiomyocytes
mze04270  Vascular smooth muscle contraction
mze04310  Wnt signaling pathway
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101487097
   04012 ErbB signaling pathway
    101487097
   04310 Wnt signaling pathway
    101487097
   04370 VEGF signaling pathway
    101487097
   04020 Calcium signaling pathway
    101487097
   04070 Phosphatidylinositol signaling system
    101487097
   04150 mTOR signaling pathway
    101487097
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101487097
   04540 Gap junction
    101487097
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101487097
   04916 Melanogenesis
    101487097
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101487097
   04270 Vascular smooth muscle contraction
    101487097
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101487097
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101487097
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101487097
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101487097
Membrane trafficking [BR:mze04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101487097
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2
Other DBs
NCBI-GeneID: 101487097
NCBI-ProteinID: XP_004558373
UniProt: A0A3P9B3M4
LinkDB
Position
LG4
AA seq 680 aa
MADHLLHYNDSAGVGNRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGK
QGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLL
YGLIHQGMKCDTCDMNVHKQCVVNVPSLCGTDHTERRGRLFLKIEVSVDRLHVTVGEARN
LIPMDPNGLSDPYVKLKLIPDPKNETKQKTRTIRSSLNPCWNESFTFKLKASDKDRRLSI
EVWDWDRTTRNDFMGSMSFGVSELIKAPTVGWYKLLNQEEGEYYNVPIPEVDDVNLELRQ
KFEDCQLNIHYLKKAKLGHGKKVITPSDHRRFSFPSGNMDRVRLNDFNFLALLGKGSFGK
VMLAEMKSTEELYAIKILKKDVVIQDDDVECTMVEKRVLALRDKPPFLTQLHSCFQTVDR
LYFVMEYINGGDLMYHIQRMGKFKEPQAVFYAAEIAVGLFFLHRKGIIYRDLKLDNVMLD
YEGHIKIADFGMCKENMYEGMTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEML
AGQPPFDGEDEDELFQSIMEHNVSYPKSMSKEAVSICKGLMTKHPSKRLGCGLEGERDIR
EQAFFRRIDWERLANREIQPPFKPKVCGKGAENFDKFFTRTQPVLTPPDQLVIANIDQGE
FAGFSYINPQFLHPSLHSVV
NT seq 2043 nt   +upstreamnt  +downstreamnt
atggctgaccatcttttacattataatgattcagctggggttgggaacagattcgcccgc
aaaggtgctttgcggcagaaaaacgtgcatgaagtgaaaaatcacaagtttactgcgaga
tttttcaagcagccgacgttctgcagtcactgtacagacttcatttggggctttgggaaa
caaggatttcaatgccaagtttgctgtttcgtggtccacaaacggtgccatgagtttgtc
accttctcgtgtcccggagccgacaagggtcccgatacagatgaccccagaagcaagcac
aagttcaagattcacacatacggcagtccaaccttctgtgaccactgtggctcgctgctg
tatgggctcatccaccaagggatgaaatgtgacacctgcgacatgaacgtgcacaaacag
tgtgtggtcaatgtgccgagcctgtgtgggacggaccacactgagcgccggggtcgcctg
ttcctcaagatagaggtcagcgtagacaggctacacgtcacagtcggagaagccaggaac
ctgattccaatggatccaaatggtttatcagacccatatgttaaactcaagctcatcccg
gatccaaagaatgaaaccaaacagaagaccaggaccatccgttcctctctcaacccgtgc
tggaatgagtccttcacctttaagctgaaagcatcggacaaggaccgtcgtctgtccatc
gaggtgtgggactgggaccgaaccactcggaatgacttcatggggtccatgtcgtttgga
gtgtctgagctcatcaaagctcctacagttggatggtacaagttgctgaaccaggaagag
ggagagtactacaatgttcccattcccgaggtggatgatgtcaaccttgagctccgacag
aagtttgaggactgccagttaaatatccactatctgaagaaagcaaagctgggacacggt
aagaaagtgatcacgccatcagaccaccggcggttcagcttcccgtcagggaatatggac
cgggtccgactcaatgacttcaacttcctggctctgctcgggaagggcagcttcggcaag
gtgatgctggctgagatgaagtcgacggaggagctgtacgctataaagatcctgaagaaa
gatgtcgtgatccaggacgatgacgtcgaatgtacaatggtggagaagagagtcttggcc
ctgagagacaaaccgcccttcctcacgcagctccactcctgcttccagacagtggatcgg
ttgtactttgtgatggagtacattaacggaggagacctcatgtatcatatccagcgtatg
ggcaagtttaaggagccacaggctgtgttttatgccgcagagattgctgtcggtttgttt
ttcttgcaccgaaaggggatcatctacagggatctgaagctcgacaatgtgatgctggac
tacgagggccacatcaagatagcagactttggcatgtgtaaggaaaacatgtacgaagga
atgaccacgcgcactttctgcggcaccccagactacatcgcaccggagattatagcatac
cagccttatgggaaatcagtggactggtgggcctatggagttcttctgtacgagatgctg
gcaggacagccgccgtttgatggagaagacgaggacgagctcttccagtctatcatggag
cacaatgtgtcctaccccaagtccatgtctaaagaagctgtgtccatctgcaaaggactg
atgaccaagcacccctcaaagcgtctcggctgtggcctggagggtgagagagacatcaga
gagcaggccttcttcagacgcatcgactgggagcgcctggccaacagagagatccagcca
ccatttaaacccaaagtgtgcggcaaaggagcagaaaactttgacaagtttttcacgcgt
acccaacccgtcctcacccctccggaccagctggtcattgccaacatcgaccagggcgag
ttcgccggcttttcctacatcaaccctcagttcctccatccatccctgcacagcgtggta
tga

DBGET integrated database retrieval system