KEGG   Maylandia zebra (zebra mbuna): 101464488Help
Entry
101464488         CDS       T02814                                 

Gene name
park7
Definition
(RefSeq) protein/nucleic acid deglycase DJ-1
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mze01002]
    101464488 (park7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101464488 (park7)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     101464488 (park7)
Peptidases [BR:mze01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   101464488 (park7)
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101464488 (park7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 101464488
NCBI-ProteinID: XP_004548635
LinkDB All DBs
Position
LG5
AA seq 189 aa AA seqDB search
MAGKRALVILSKGAEEMETVIPVDIMRRAGIAVTVAGLTGKEPVQCSRNVVICPDASLEE
ARKQGPYDVVLLPGGMPGAQNLAESPAVKEVLKDQDGRKGLIAAICAGPTALLAHGIGFG
STVTTHPAMKEKMMAGDHYKYSEARVQKDGHYITSRGPGTSFEFALTIVEELMGAEVAAQ
IKTPLIMKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaagagggcgttagtaatcctgtctaaaggcgcagaggagatggaaactgtt
attcccgtggatattatgcgcagagctgggatagcagtgacggtagctggtcttacgggc
aaagaaccagtccagtgtagcagaaacgttgtcatttgtcctgatgccagtctggaggag
gcgaggaaacagggcccttatgatgtggtcctgctaccaggaggaatgccaggagcccag
aatctggcagagtctcctgctgtgaaggaggtgctgaaagatcaagatggcagaaaaggc
ctgattgcagccatctgtgcaggtcccactgctcttctggcacatggcattggcttcggc
agcacagtgactacacatcctgccatgaaggagaagatgatggctggagaccactataaa
tattcagaggctcgagtacagaaggatggacattacatcaccagccgtgggccaggaacg
agttttgagtttgccctgacgattgtagaggaacttatgggggctgaggttgcagctcaa
atcaagactcctcttattatgaaagactga

DBGET integrated database retrieval system