KEGG   Maylandia zebra (zebra mbuna): 101464606
Entry
101464606         CDS       T02814                                 

Definition
(RefSeq) transcriptional regulator Myc-2 isoform X1
  KO
K04377  Myc proto-oncogene protein
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04110  Cell cycle
mze04218  Cellular senescence
mze04310  Wnt signaling pathway
mze04350  TGF-beta signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101464606
   04012 ErbB signaling pathway
    101464606
   04310 Wnt signaling pathway
    101464606
   04350 TGF-beta signaling pathway
    101464606
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101464606
   04218 Cellular senescence
    101464606
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101464606
Transcription factors [BR:mze03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    101464606
Messenger RNA biogenesis [BR:mze03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     101464606
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ DUF3697
Other DBs
NCBI-GeneID: 101464606
NCBI-ProteinID: XP_004575737
LinkDB
Position
Unknown
AA seq 385 aa
MLLKSSPPSKTPSQAAVMPPVLNSTNYDYDYDVVQPYFFLNGEEEDFYPPPRSQLLPAPS
EDIWKKFELLPTPPLSPSRRPSLSAADHLEAVSDLLDDDHSSSAAFLQSFIIQDCMWSSS
FAAATELEKVVSERLASLRARRDSCNTKTITDRTADEQVGGSQVSAGYLQDFHTSVTDCI
DPSVVFLGEKQMDDGVAMEVGSELRLDSPPPSSSDSESEEEDDEEEEEEIDVVTVDRRKS
SRRSHTSPLVLKRSHVNIHQHNYAAQQPPEKRVKAESSSAAPRQSGGRRCWSPKSEGEDN
DKRRTHNVLERQRRNELKMSFMVLRDEVPAVANNEKAAKVVILKKAAEFIMEVREQERKL
LAKKDELRKRSRELKQRLQQLRTSH
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgctgttaaaaagctcaccaccctccaaaacaccttcacaggccgccgtcatgccgccg
gtgttgaacagcacaaactacgattatgactacgacgtggtccagccctacttcttcctg
aatggtgaagaggaagacttctaccctcctccacgcagccagctcctgccggctcccagc
gaagacatctggaagaagttcgagctgctgcctacacctcccttgtcccccagccggaga
ccctccctgtctgccgccgaccacttggaggcggtgtctgacctcttggacgatgaccac
agctcctctgcagcatttctgcagtccttcatcatccaggattgcatgtggagcagcagc
ttcgccgccgccacagagctggagaaggtggtgtcagagaggctggcctcgctgcgggcc
cgccgggactcctgcaacactaagaccatcacagacagaacagctgacgagcaggtgggc
gggtctcaggtgagcgctgggtacctgcaggacttccacacctcggtgacagactgcatt
gacccctctgtggtgttcctgggtgagaagcagatggatgatggtgtggcgatggaggtg
gggtctgagctgagactggactcgccaccacccagcagcagtgacagcgaatcagaagag
gaagatgatgaagaggaagaggaagagatcgatgtggtgacagtggacaggagaaagtca
tctcgacggtcccacacctcccctctggtcctgaaacgctctcatgtcaacatccaccaa
cacaactacgctgcccagcaaccccctgagaaacgtgtgaaggcggagagcagcagcgcg
gcaccgaggcagagcggcgggcgccggtgctggagcccgaaatcggagggcgaggacaac
gacaagcgcaggactcacaacgtgctggagaggcagcggagaaacgagctgaagatgagc
ttcatggttctgagggacgaggtcccagcggtggccaacaatgaaaaagcggcgaaggtg
gtgatcctgaagaaggcggcggagttcatcatggaggtcagagagcaggagaggaagctg
ttggcaaagaaagatgaactgaggaagaggagcagagagctgaagcagaggctgcagcag
ctcaggacttcacattaa

KEGG   Maylandia zebra (zebra mbuna): 101474120
Entry
101474120         CDS       T02814                                 

Gene name
myc
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04110  Cell cycle
mze04218  Cellular senescence
mze04310  Wnt signaling pathway
mze04350  TGF-beta signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101474120 (myc)
   04012 ErbB signaling pathway
    101474120 (myc)
   04310 Wnt signaling pathway
    101474120 (myc)
   04350 TGF-beta signaling pathway
    101474120 (myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101474120 (myc)
   04218 Cellular senescence
    101474120 (myc)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101474120 (myc)
Transcription factors [BR:mze03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    101474120 (myc)
Messenger RNA biogenesis [BR:mze03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     101474120 (myc)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH BSP_II CENP-B_dimeris Astro_capsid_p NOA36 DUF2847
Other DBs
NCBI-GeneID: 101474120
NCBI-ProteinID: XP_004552045
UniProt: A0A3P9CQ97
LinkDB
Position
LG9
AA seq 437 aa
MPRNPSLASRNYDYDYLQPYFYYDDEEEDFYPQQFQPPAPSEDIWKKFELLPTPPLSPSR
RPSLSSLDLSIADQLEMVTEFLGDDVVNQSIICDSDYSQTFLKSIIIQDCMWSGFSAAAK
LKKVVSERLASLHAARKESAAGDGAELAGPAAAAAAAAAAATAALPAWKLNSSYLQDLNT
SASECIDPSVVFPYPVAETPKQSAGTPPSKDLGLDTPPNSSGSSSSCSDSEEEDEGDDEE
EEEEEEEEEDEQEEEEEIDVVTVEKRQVVKRCDSSPLETRHPSPLVLKRCHVSTHQHNYA
AHPSMRHEQPAVKRLKLESSGGGASSHSRVLKQISSNRKCSSPRTSDTEDYDKRRTHNVL
ERQRRNELKLSFFALRDEIPEVANNEKAAKVVILKKATECIYSMQSDEQRLLSLKEQLRR
RSEQLKQRLAHLQGCRA
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgccgcggaatccaagtttggcgagtaggaactacgactacgactacctgcagccctat
ttctactacgacgacgaggaggaggatttctaccctcagcagtttcagcctccggcaccc
agcgaagacatctggaagaaatttgaactgctgccgacccctcccctctccccgagccgc
cggccgtccctgtccagcctcgacctttccatcgcggatcagctggagatggtgacagag
ttcctcggggatgacgtggtcaaccagagcatcatctgcgactccgactactcccagacc
ttcctcaagtccatcatcatccaggactgcatgtggagcggcttttccgccgccgccaag
ctgaagaaggtggtgtccgagcggctcgcctccctgcacgccgcccggaaggagtctgcg
gccggtgacggcgcagagctcgccggccccgcggctgctgccgccgcggctgccgccgcc
gctactgcggctcttcctgcgtggaagctgaacagcagctacctgcaagacctgaacacg
tctgcgtcggagtgcatcgacccctcggtggttttcccgtatcccgtagccgagacgccc
aagcagagcgcagggaccccgcctagcaaggatttgggactagacacgccgcctaacagc
agcgggagcagcagcagttgtagcgattcagaggaagaggatgaaggtgatgatgaggag
gaggaggaggaggaagaagaagaagaggacgaacaggaggaagaggaggaaatcgacgtg
gtcactgtggaaaagaggcaggtggtgaaacggtgcgactccagcccgctggagaccagg
caccccagcccactcgtgctgaagaggtgccacgtctccacccaccagcataattacgcc
gcccatccatccatgaggcacgagcagccggctgtcaagaggctgaagctggagagcagc
ggtggaggtgccagcagccacagcagggtcctcaaacagatcagcagcaaccgcaagtgt
tccagcccgcgaacgtcggacacggaggactacgacaagagaaggactcataacgtgctg
gagcgccaaaggaggaacgagctgaagctgagcttcttcgctctgcgggacgagatcccc
gaggtggccaacaacgagaaggcggccaaggtggtcatcctgaagaaggccacggagtgc
atctacagcatgcagtcagacgaacagagactcctctctctgaaagagcagctgaggagg
agaagcgaacagttaaagcagagactcgcacacctgcagggttgccgtgcttaa

KEGG   Maylandia zebra (zebra mbuna): 101479046
Entry
101479046         CDS       T02814                                 

Definition
(RefSeq) transcriptional regulator Myc-A
  KO
K04377  Myc proto-oncogene protein
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04110  Cell cycle
mze04218  Cellular senescence
mze04310  Wnt signaling pathway
mze04350  TGF-beta signaling pathway
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101479046
   04012 ErbB signaling pathway
    101479046
   04310 Wnt signaling pathway
    101479046
   04350 TGF-beta signaling pathway
    101479046
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101479046
   04218 Cellular senescence
    101479046
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101479046
Transcription factors [BR:mze03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    101479046
Messenger RNA biogenesis [BR:mze03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     101479046
SSDB
Motif
Pfam: HLH Myc_N Myc-LZ
Other DBs
NCBI-GeneID: 101479046
NCBI-ProteinID: XP_004548888
UniProt: A0A3P9CGR2
LinkDB
Position
Unknown
AA seq 355 aa
MLESFTQSQDWFCSEPLLFDDEFCQSLMKDLQALPTPPQSPPMKSGLGGDKPLSKEDQLS
YVSDILLEDHDMQLNWQCDFFHSDAEKEGELNQPCSEEAEDCLWQCLAAEEKLVSSLLGC
SPVLSDIDTRIFEEIAGSTLDCQSLMEAPEPSEATSDYGSVGGELSTYSSSDSEEEIDVV
TVVRCSSSSSPEPTLAERQQKQEEEQRARQRYRFEIQLQHNYAAPCPASPPPSNKRARGS
DGPSRFHCLSRSSSSTSSRHSSRNSTETEDEEERRKTHNVMERQRRNELKNCFMRLRDNV
PELSHNDKASKVVILKKARDCIYSLEDESHRLQTRKDKLKAKQEKLKARLEQLRR
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgttggaaagtttcactcagtcgcaggactggttttgttcagagccgctgctctttgat
gacgagttctgccaaagcctgatgaaagacctccaggcattaccgacacctccgcagtcg
ccccccatgaagtctgggctgggtggtgataagcctctgtccaaggaggaccagctcagc
tacgtgtcggatattctactggaggaccatgacatgcagctcaactggcagtgtgacttc
ttccactctgatgctgagaaagaaggcgagcttaaccagccctgctctgaggaagctgag
gactgcctctggcagtgcctggcagctgaggagaagcttgtctcctcactactcggttgc
agccccgtactatctgacattgatacccgcatctttgaggagatcgccggctccacactt
gactgccagagccttatggaagctccggagcccagtgaagccacatcagactacggatca
gttggtggcgagctgtccacatattcatctagcgactctgaggaggaaattgatgtggtg
actgtggtccgctgttcctcaagttcctcccctgagcctacattggctgaacgtcagcag
aagcaagaagaggaacaacgtgctcggcagcgataccgctttgaaatccagctacagcac
aactacgctgctccctgccctgcatcaccgccgccatcaaacaagcgtgcacgagggagc
gatggcccgtcacgcttccactgcctttcacgcagttcttcatcaacctcatcgcgtcac
tcatcccgaaactcaacagagacggaggatgaggaggagcggagaaagactcacaatgtg
atggagaggcaacgccgaaacgagctaaagaactgtttcatgcgcttgcgtgacaacgtg
cctgagttgtcgcacaatgacaaggcatctaaggtggtgatcttgaagaaagccagagac
tgtatttatagtttagaggatgagtcccacagactgcaaaccaggaaagacaaacttaaa
gccaaacaggaaaagctgaaagccagactagagcagctccgtaggtaa

DBGET integrated database retrieval system