KEGG   Maylandia zebra (zebra mbuna): 101464707
Entry
101464707         CDS       T02814                                 

Gene name
nrg3
Definition
(RefSeq) pro-neuregulin-3, membrane-bound isoform isoform X2
  KO
K05457  neuregulin 3
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101464707 (nrg3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mze04052]
    101464707 (nrg3)
Cytokines and growth factors [BR:mze04052]
 Growth factors
  Growth factors (RTK binding)
   101464707 (nrg3)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 101464707
NCBI-ProteinID: XP_004553600
LinkDB
Position
LG13
AA seq 711 aa
MSHKGRQGMMSECSGAAASGAVILEEPEGSGASAGRGEGQAQEQGPLRCAVWPRQQTWLC
VVPLLIGFIGLGLSLMLLKWIVVGTVRDYVPTDLVDANRIGQDPIFLSKPSGIPKSPDTT
TTTTTPTIDSRNPTARTATVAKGRTRTTATTTTINARGGGASGSQVTPRNPGSRNGRGPS
GFTTTTAAPRTTFIIGAATSSSSPPNPTVLHDSTQMWTAEHTTTETISTTLTTRTHSHRK
TPSPTVPPLHSEHFKPCHEKDLAYCLNGGECFVIETLSGPHKHCKCREGYQGIRCDQFLP
KTDSILSDPNHLGIEFMESKEVYKRQVLSITSIAMAISLLGTLCMALYCRNKRRREKLQA
HLKESRSLKNYTTSSHNALEAKMRASNTNLQIHECCKRPSQSRQGNVCESSFSHCSITTA
PPRSSRGTVKHHRSSSLSHSPDQRMRAAHWSASRRTPPIPKGRLNPIGVSKYSGPAYQHL
QEVDSSEKEAEAQRGVQVQGENQCDDTFLHMQAPAMQALSPSPWSGCVEVRAHLCPPSEP
NPTTRSLRRPGRRQSHSPPPPFRSCSIPIIPSVQCHHDNEVSCMQTTPATTTMSVTCGAM
PCKEEKNEKAAHAPLFSSSCSSAIGRQQDEVALLLEEAQEQLRALALAHRKQEGGGVFTG
TSTVALVEARETVCFLNVNGGSAGALSCNGPTQTQLLSPSLSHRDLGQTGQ
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgagccataaaggacgacagggaatgatgagtgagtgttctggggcagctgcatctggg
gcagtaatcctggaagaacctgaaggttcgggggcttctgcgggccggggggagggccag
gcccaggaacagggtccccttcgctgtgcagtttggcctcgtcagcagacatggctgtgt
gtggttcctttacttattggttttattggccttggattgagcctgatgctgctgaaatgg
attgttgttggtacagtgagggattacgtcccaacagatctagtggatgcaaatcgaata
ggacaagatcccatcttcctctccaagccaagtgggattcccaagagccccgatactacc
actactacaactactcctacaatcgatagcaggaaccccactgctagaactgctactgtg
gcaaaaggtagaactcgcactactgctaccaccacaactataaatgctagagggggtggg
gcgtcaggcagtcaggtaactcctcggaatcctggaagtcgtaatggacgtggaccttca
ggttttaccacaactactgcagcaccacgtacaactttcataattggagctgcaacatct
agctcctcaccgcccaatccgacggttcttcatgactctacacagatgtggacggcagaa
catactactacagagacgatctccaccacactcactacacgtacgcacagtcaccgcaaa
accccatctccaactgtccctccgctacactcggagcatttcaagccctgtcatgagaag
gacttggcctactgcctaaatggtggcgaatgctttgtcatcgagacactcagcgggcct
cacaaacactgcaagtgtcgagaaggataccaaggaatccgctgtgaccagtttctgccc
aagactgactccatcctgtcggacccaaatcacttgggcatcgagtttatggagagcaaa
gaggtgtataagagacaggtgctgtcaatcacatccatcgccatggcaattagcctcctg
ggaacgctgtgcatggccctctactgccgcaacaagaggcgcagagaaaaactccaggcc
cacctgaaggagagtcgcagtttgaaaaactacactactagttcccataatgccctagaa
gccaaaatgagggcctctaacaccaacctgcaaattcatgagtgctgcaaacggccatcc
cagtctcgccagggaaacgtctgcgagtccagcttttcacactgcagcatcacgactgcg
ccacccagaagctccagaggcacagtaaaacatcacagaagcagttccctgtctcacagc
cctgaccagagaatgcgggcagcccattggtcagcttctcgccggactccacccataccc
aaaggaagattaaacccaattggagtttccaagtattctggccccgcctaccagcacctt
caggaagtggattcatctgagaaggaagcagaagcacaaagaggtgtccaagtgcaggga
gagaaccagtgtgatgacaccttcctacatatgcaagctcctgcgatgcaggcattgtcg
ccatcgccttggagcggctgcgtggaggtacgcgcacatctgtgtcctccatctgaaccc
aatcccaccactcgcagcctgagaaggccgggacgccgtcaaagccactccccacctccc
ccgttccgctcctgctctattcccatcattccatctgtgcagtgtcaccatgacaatgag
gtgtcttgcatgcaaaccaccccagcgaccacaacgatgtcagtcacctgtggggccatg
ccttgcaaggaggagaagaatgaaaaggcagcgcacgccccgttgttttcatcttcctgc
tcgtctgccattggacggcagcaggatgaggtggccctgctgctcgaagaggcacaggag
caactcagggcgttggcgctggctcacaggaagcaggaggggggcggagtcttcaccggc
acctcaacggttgcgctggtggaagccagagaaactgtttgcttcctgaacgttaacgga
ggaagtgccggggcgctgagctgtaacggacccacgcagacccagctactcagccccagc
ctatcacacagagacctgggccaaaccggccaatga

DBGET integrated database retrieval system