KEGG   Maylandia zebra (zebra mbuna): 101464777Help
Entry
101464777         CDS       T02814                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase EZH2
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101464777
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mze03036]
    101464777
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101464777
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101464777
   Polycomb group proteins
    PRC2-EZH2 complex
     101464777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET EZH2_WD-Binding
Motif
Other DBs
NCBI-GeneID: 101464777
NCBI-ProteinID: XP_024656194
LinkDB All DBs
Position
Unknown
AA seq 760 aa AA seqDB search
MVLTGKRSGKGPACWKRRVKSEYMRLRQLKRFRRADEVKSMFNSNRQKIMERTDILNRSG
NPANPAVHIMTSFSSLRGTRECTVESGFSEXPRQVIPLKTLNAVASVPVMYSWSPLQQNF
MVEDETVLHNIPYMGDEILDQDGTSSKSSSNYDGKVPETECGFINDEIFVELVNALAQYS
DNEDDEEEEEQDFKVDKMDVCDGKEHPEEPRKDGLVNNESRTNNDTSKKFPSDKIFEAIS
SMFPDKGSPEELKEKYKELTEQQLPGALPPECTPNIDGPNARSVQREQSLHSFHTLFCRR
CFKYDCFLHPFHATPNTYKRKNLENLVDKNPCGIDCYMDLVQDGMMREYATGVGTERAKT
PSKRNGGRRRGRLPNSNSNSRPSXPTVSSETKDTDSDREGSKEDERDNDKDDEDKKDETT
SSSEGNSRCQTPVKMKLSGEAEAVEWSGAEASLFRVLIGTYYDNYCAIARLIGTKTCRQV
YEFRVKESAIIARAPAEDEDTPPRKKKRKHRLWATHCRKIQLKKDGSSNHVYNYQPCDHP
RQPCDSSCPCVTAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPXLCL
TCGAADHWDSKNVSCKNCSIQRGAKKHLLLAPSDVAGWGIFIKEPVQKNEFISEYCGEII
SQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDH
RIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIA
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgactgggaagcgttcgggaaaaggccccgcctgctggaagaggagggtgaag
tctgagtacatgaggcttcggcagctgaaacgcttcagacgggctgacgaggtcaagagc
atgttcaacagcaaccgtcagaaaatcatggagcgaactgacattttgaacaggagtgga
aacccggcgaatccagccgttcacatcatgacgtcgttcagctccttacgagggactcga
gagtgcaccgtggagagcggcttctccgagntccctcgacaggtcatccccctgaagact
ctgaacgccgtggcctcggtcccggtcatgtactcctggtcgccgctacagcaaaacttc
atggtggaggatgagacggtgctccataacattccctacatgggagacgagatcctcgac
caggacgggacttcatcgaagagctcatcaaactatgacggcaaagtcccggagacagag
tgtggcttcatcaacgacgagatcttcgtcgagttggtcaacgctctggcacagtacagt
gacaacgaggatgatgaggaggaggaagagcaggactttaaagtggacaagatggacgtg
tgtgatggcaaagagcacccagaggagccccgcaaggatgggcttgttaacaatgagagc
cgaaccaacaatgacaccagcaagaagtttccctctgacaagatttttgaggccatctcc
tccatgttccccgacaagggctcccccgaggagctcaaagaaaagtacaaggagctgact
gagcagcagctgcccggcgccctgccgcctgaatgcacgccgaacatcgacggtccgaac
gctcgctccgtgcagcgcgagcagagcctgcactccttccacactctgttctgcagacgc
tgcttcaaatacgactgcttcctccaccctttccatgcaactcccaacacgtacaagcgc
aagaacttggagaacctggtggacaaaaacccgtgtggcatcgactgctacatggacctg
gtgcaggacggcatgatgagggagtacgccacaggcgtgggaaccgagcgggcaaagacg
ccctccaagcgtaacgggggccggcgccgcggtcggctgcccaacagcaacagtaacagc
cggcccagcnaccccacggtgtcctctgaaaccaaagacacggacagcgaccgcgagggc
agcaaagaggacgagcgagacaacgacaaagacgacgaggacaagaaggacgagaccacc
agcagctcagagggaaactcgcgctgtcagactcccgtgaagatgaagctgtccggtgag
gccgaagcggtggagtggagcggcgctgaggcgtctctcttcagagtcctcatcgggacg
tactacgacaactactgcgccatcgcgcggctcataggcaccaagacctgcagacaggtt
tacgagttcagggtcaaggagtcggccatcattgctcgcgctcccgctgaagacgaggac
acgccgccgaggaagaagaagaggaagcacagactgtgggctactcactgccgcaagatc
cagctgaagaaagatggctcatccaatcacgtgtataactaccagccatgtgaccacccc
cgtcagccctgcgactcctcgtgtccctgcgtcaccgcgcaaaacttctgtgagaagttc
tgccagtgcagctcggagtgtcagaaccgcttcccgggctgccgctgcaaagctcagtgt
aacaccaagcagtgcccctgctacctggcagtgagggagtgcgaccccnncctctgcctg
acctgcggcgccgccgaccactgggacagcaagaacgtgtcctgcaagaactgctccatc
cagagaggcgccaagaagcacctcctgctcgctccgtcagacgtggccggctggggcatc
ttcatcaaagagccggtgcagaaaaacgagttcatttcggagtactgtggagagatcatc
tctcaggacgaagccgaccgcagaggcaaagtctacgacaaatacatgtgcagcttcctg
ttcaacctgaacaacgactttgttgttgatgccacgaggaaaggcaacaagatccgcttc
gccaaccactcggtgaacccgaactgctatgcaaaagtgatgatggtgaacggcgatcac
aggatcgggatctttgccaagagagccatccagaccggagaggagctcttcttcgactac
aggtacagccaggccgacgctctgaagtacgtcgggatcgagcgtgagatggagatcgcc
tga

DBGET integrated database retrieval system