KEGG   Maylandia zebra (zebra mbuna): 101465105
Entry
101465105         CDS       T02814                                 

Definition
(RefSeq) receptor tyrosine-protein kinase erbB-3 isoform X2
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101465105
   04012 ErbB signaling pathway
    101465105
   04020 Calcium signaling pathway
    101465105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101465105
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101465105
Protein kinases [BR:mze01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101465105
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr GF_recep_IV Recep_L_domain Furin-like Pkinase Kinase-like
Other DBs
NCBI-GeneID: 101465105
NCBI-ProteinID: XP_004558838
LinkDB
Position
LG20
AA seq 1460 aa
MEQWRVILLGVILSWRLRTSSQTHEEVCPGTQNGLSSTGSQENQYNLIRNRYYGCEIVMG
NLEITQIESNWDFSFLKRIREVTGYVLIAMNHFQEIPLGQLRVIRGNSLYERRFALSIFL
NYPKDGSNGLQQLGLANLTEILEGGVQIINNKYLSYGPWIFWQDIVRDSSAPIDIKYNGK
KGPCHKSCGDYCWGPNEKQCQILTKTVCAPQCNSRCFGTSPRDCCHIECAAGCKGPQDVD
CFACRHFNDSGACVPQCPRALIYNKQTFQMETNPNAKYQYGSICVSQCPTHFVVDGSSCV
SACPSDKMEVEKEGQRKCELCSGLCPKVCEGTGAEDRQTVDSSNINSFINCTKIQGSLHF
LVTGIMGDDFRNIPPLDAKKLEVFRTVREITDFLNVQSWPKELNDLSVFSSLTTIQGRTL
YNHFSLTVMRVPTLTSLGLRSLKEISDGSMYISLNSNLCYHHTVNWTKLFRGRRVRGNNL
SNNKPLAECVAEGHVCDPLCSDAGCWGPGPEQCLSCRNYSRDGTCVHSCNFYNGAPREFA
GPDGECTACHPECKTQSGKVTCTGLGSDDCVACASFQDGPFCMSSCPTGINDGQKGLIFK
YPDRKGHCQPCHHNCTQGCIGPGLMDCLETARLAVSSGQITGIALGVPAGLIFCLVLFFL
GMLYHRGLAIRRKRAMRRYLESGEQSFELLDPGEKGTKVHARLLRPSELKKVKALGVGVF
GTVHKGFWTPEGETVKIPVAIKTIQDSSGRQTFTEITDHMLSMGSLDHPYIVRLLGICPG
ASLQLVTQLSSQGSLLEHIRQKKNSLDPQLLLNWCVQIAKGMYYLEEHCMVHRNLAARNI
LLKNDYQVQISDYGVADLLYPDDKKYVYTDTKTPIKWMALESILFRRYTHQSDVWSYGVT
VWEMMSFGAEPYASVSPQEVPGLLEKGERLSQPHICTIDVYMVMVKCWMIDENIRPTFKE
LASDFTRMARDPPRYLVIKLEGEEPVPDATHRRESERGLLDPGLEDQDEEGLEEGLATPP
LQNSPSWSVSRSRINSCRSGSYQPGNIGYLPMTTSPADSFRQLWFHRSRLSSVRTLPERL
EVRGSGREAEVHEEGLRTASLHRARIGSERSNRRVPISQQRKLSTASSPPSYKVWTAEEE
EEVDSYGYVLPGSPSTPERVQISRISHSGQRNSRPLFMVINPTQEYEIMNTEESTPPRLA
SSVSRQEDDPTVGICCKTPPLPSPTFMALLPIEDIAHEETLPPDSAVRRNPLHEACEGTA
EERINSAEKQPLTSDFTSDIRAVDDPGEPAQGNGRYEYMDIRHSDSTERDESSQERRGSQ
TSAKSAAEEQEIHQTVEVLKKEHKEEEEKEETQNTNNKATLSSTAMPRPDVLKGGGEKVE
EYEEMNRFGVVPSRCKETEYQNLPVKGRVICEEMGSGRCTEIGEYIKVCAGVGEPASNTS
FDNPDYWHSRLFLKPDAVRT
NT seq 4383 nt   +upstreamnt  +downstreamnt
atggagcagtggcgagtcattttactgggagtgattttgtcttggaggcttcgaacatca
tcccaaacgcatgaagaagtgtgtccagggacgcagaatggactcagttccacaggctct
caggagaaccagtacaatctgattagaaaccggtattatggctgtgagattgtaatggga
aacctggagatcacacagattgagagtaactgggacttctccttcctcaagagaatccgt
gaggtgactggctatgtccttattgctatgaatcactttcaagagattcctctgggccaa
ctgcgcgtcatcagaggaaacagcctgtatgaaagacgttttgctctatcgatcttcctc
aactaccccaaggacggctccaacggcctacagcagctgggactcgcaaacctgacggag
attctggagggaggggtgcagattatcaataacaaatacctgagttatggtccctggatc
ttctggcaggatattgtccgggacagcagcgctcctattgatatcaaatacaatggaaag
aaaggcccatgccataaatcttgcggagattattgctggggaccaaacgaaaagcaatgc
cagatcttgactaagacggtgtgcgctccacagtgtaacagccgctgctttggcacaagc
ccgagggactgctgtcacatagagtgtgcagcaggatgtaaaggcccccaagatgtggac
tgttttgcatgtcgtcatttcaatgactccggagcctgtgtgccgcagtgtccccgggct
ctgatctataacaagcagacgtttcaaatggaaaccaaccctaatgccaaataccaatac
ggatccatctgtgtgtctcagtgccccactcattttgtggtggatggtagctcctgcgtg
agcgcctgtccgtcagacaagatggaggtggagaaagaaggccagaggaagtgtgagctc
tgcagcggactttgcccaaaagtgtgtgaaggcactggtgctgaagacaggcagactgtg
gactcgagcaacatcaacagcttcatcaactgcaccaagattcagggcagccttcacttc
ctggtcacggggattatgggagatgattttagaaacatcccaccactggatgccaaaaag
ctggaagtgttccgcacagtcagggaaataacagactttttaaacgtccagtcctggccc
aaagagctgaatgacctgtctgttttttcaagcctcactaccattcaagggaggacgctc
tacaaccatttttctctgacggtcatgcgcgtccccactcttacctcactgggtctgcgc
tctctgaaagaaatcagtgacggcagcatgtacatcagtctgaacagcaatctctgctac
caccacactgtaaactggacgaagctgttcaggggccgccgagttcgaggcaacaacctc
agcaacaacaagccattggcagagtgtgttgcagaaggccacgtgtgtgatccgctatgt
tcagatgcaggatgctggggcccagggcctgaacagtgtctttcctgtaggaactacagt
cgagacggcacatgtgtgcacagctgtaatttttacaacggggcaccaagggaatttgca
ggtcctgatggcgagtgtaccgcctgtcacccagaatgcaagactcagagtgggaaagtc
acctgcactggactgggttcagatgactgcgtggcttgtgccagttttcaagatggtcct
ttctgcatgtcctcttgtcccactgggataaatgatggacagaagggactcattttcaaa
taccccgacaggaagggtcattgtcaaccgtgtcaccacaactgcacacagggatgcatt
ggcccaggattaatggactgtttagagacagccagactggcagttagtagtggtcagatc
acaggcatagccttgggtgtcccagctggcttaatcttctgcctggtgttatttttcctg
ggcatgctttaccacagaggacttgccatccgtcgcaagagggctatgaggaggtacctg
gagagcggagagcagagctttgagctgctggatcctggagagaaaggcaccaaggttcat
gcccgccttctgaggccctcagagctgaaaaaagtcaaagcccttggcgtgggtgttttt
ggcactgtgcacaagggcttttggactccagaaggagagacggtaaaaatacccgtggcc
attaagacaatccaggatagctcaggccgacagactttcactgagattactgatcatatg
ctctccatgggcagcttggaccacccttacatcgttaggctgctgggcatctgcccaggt
gccagtctgcaactggtgacccagctcagttcacaaggttcgctgctggagcacatcagg
caaaagaagaacagcctggatccccagctcctgctcaactggtgtgtgcagattgcaaag
ggcatgtactatctggaagagcactgcatggtccacaggaatctggctgcacgcaacatc
ttactgaaaaatgactatcaggtccagatctccgactacggcgtagcagacctcctttac
cctgatgacaagaaatacgtctacacagacacaaagacgccaataaaatggatggcactc
gaaagcatcttgtttcgaagatatactcatcagagtgacgtctggagttatggggtgaca
gtgtgggagatgatgtcatttggggcagagccatatgcatccgtgtcacctcaggaagtg
ccgggtctgctggagaagggcgaacgtctgtcacagccccacatctgcactatagacgtg
tacatggtcatggtgaaatgctggatgattgatgaaaacataaggcccaccttcaaagaa
ctggccagtgacttcactcgcatggcgagggacccaccgagataccttgtcatcaagctg
gaaggagaagaacctgtcccagatgcaacccatcgaagggagtcagagcgaggacttctg
gatccaggtttagaagaccaagatgaggagggactggaggaaggtttggctacacctcct
cttcagaactcgccgtcgtggagtgtttctcgttctcggattaattcatgcaggagtggc
tcatatcagcctggaaatataggatacctgccaatgaccacgagcccagcagacagcttc
cgccagctgtggtttcacaggtctcgtctgagctcagtccggactctgcctgagaggtta
gaggtcagggggagtggcagagaggcagaggtgcatgaagaaggcttacggacggcgagt
cttcacagggccaggattggctcagagaggagtaatcgtcgtgtaccgatcagccaacag
agaaaactttcaacagcctccagtccaccctcgtacaaggtgtggacggcagaggaagag
gaggaggtggacagctatggctatgtcctacctggctcacctagtacaccagaaagagtt
caaatctccagaatttctcattctggccaaagaaactcaaggcctcttttcatggtgata
aatcccacccaggaatatgaaatcatgaacacagaggagagcactcctcctcgtttggcc
agcagcgtttcaagacaggaagacgaccccactgtggggatttgctgcaaaaccccaccc
ttaccctccccaacattcatggctctgttacccatagaggacatagcacacgaagaaact
ctgccaccagactcagctgtaaggaggaatccacttcatgaggcttgtgaaggaactgca
gaagagcgaataaactctgcagagaaacagccgctcactagtgacttcactagtgatatc
agagctgtggatgacccaggagagccagcccaagggaatggcaggtatgaatacatggac
atcaggcactctgactctacagaacgagatgaatcatcacaagagagacgtgggagtcaa
acatctgcaaagagtgcagcagaagaacaggaaatacaccaaacagtggaggtgttgaaa
aaggagcacaaagaggaagaggaaaaggaggaaacccagaacacaaacaacaaagccact
ctaagcagtacggccatgcccaggccagatgtgctgaaaggtggaggagaaaaggtggag
gagtatgaggagatgaacagatttggggtggtgcccagcagatgtaaggaaacagaatac
cagaacctcccagtaaaggggagggttatttgtgaggagatgggcagtggcaggtgtaca
gagattggggaatacatcaaggtgtgcgctggtgtgggggaacctgcaagcaacacatca
ttcgacaacccagactactggcacagcaggctgttcctcaaaccagatgctgtgcgcacc
taa

KEGG   Maylandia zebra (zebra mbuna): 101469990
Entry
101469990         CDS       T02814                                 

Definition
(RefSeq) receptor tyrosine-protein kinase erbB-3 isoform X1
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101469990
   04012 ErbB signaling pathway
    101469990
   04020 Calcium signaling pathway
    101469990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101469990
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101469990
Protein kinases [BR:mze01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101469990
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like
Other DBs
NCBI-GeneID: 101469990
NCBI-ProteinID: XP_014264429
LinkDB
Position
LG5
AA seq 1413 aa
MKVLVKKVQQALYVLLPCVLQLCCAQTQGVTVCDGTKNFLSTTGNSEIQYNLMKTRYNNC
DIVMGNLEITMMDHTRDFSFLESIKEVTGYILFAINEFSRLPLHHLRIIRGSTLYEDQYA
LAVMVNYQRDGEHGLQELGLTHLTEILRGGVKIIQNKYLSYAPLVNWLDIVKDGTAQIVI
EDNGPEKPCHKACGDVPCWGPGNDTCQILTKTVCAPQCSGRCFGRNPSECCHVECAGGCT
GPKDTDCFACRNFNNSGSCVPQCPQTVIYNRLTYRMEPNPNAKYQYGSICVTQCPKIFVV
DGSSCVSNCPSNKMEVEKNGVKTCEPCKGLCPKVCHGTSWTDSNSETVDARNIESFINCT
KIQGSLNFLVTGIEGDAYNKVPPLDPEKLKIFNTVEEITDFLNIQSWPASMSDLSVFSNL
QTIQGRKLYKGVISKRSYALMVVKINSLTSLGLRSLQNINDGAVYIKGNKNLCYHDTVNW
TRLLGSRPQKRSKLLDVTDNQKKDECVKEKHVCHPLCSSDGCWGPGPDQCVSCKKYSRGG
TCVPDCMFLTGKQREFATKSGECLPCHPECKVQEGKETCTGPGANKCLACASLKDGPHCV
SMCPEGVMGQEGTIFKYPDKEGNCKPCHNNCTQRCTGPGIGDCTISSRYISGQMTTAIVL
GVIALIFASFSIFVLSILYRRSLAIRRKRAMRRYMMNSESFEPLEDKGTKYEARTLKPTE
LRKIRLLGNGVFGSVHKGVWIPEGDTVKLPVAIKTIDDRSGRRKFSGVTDHMRTMASLNH
INVVRTLGICPGDSLQLVIPLNRQGSLLAHVKKNKGKLSPQRLLNWCVQIAKGMNYLEEN
RMVHRNLAARNVLLNDNFTAQVSDYGIADLLYSDDKKYYCNEPKTPIRWMALESILFRRY
THQSDVWSYGVTIWEMMSYGAEPYSTMRPQEVPDLLEKGERLPQPQICTIDVYMVMVKCW
MIDENVRPTFKELASEFTRMARDPPRYLVIKEDCSQQDSSPDEPIQRSADLDDLDDVDVN
LEDPLADEKEDDLSPANYYMAKSLNRYSRMDTPKVILNSSSGTGYLPMTSGVDNHTQAMW
QSRSRLNSARTVSESSEGCGTGMEMEMGEDFPLAGSLKRRRHREDSAYVSQRDSMSGGPP
ETPSPEMEEEDQNGYVLPGGSPERDTLLFSSRAAPGRMGKSRSSELLDDPDDEEYEYMNK
QVCLTPVSLRQGSQWLKPNKKRTSSMSSHVTASSCDTGVSVEVRGSYTRSKDNSDSEQQG
SSEVEYEYMDIRGGEKLEGPPVRDPPPPPAPVRMSSKVEEEEDEYVEDGNYHYTNRQPKL
RQALQDKKELNVEGTEADEYEDMDCFSAPPPGGDGVVYQNLQREENGAAGRREQHQSMRA
GVRVTEPAVGDRSFDNPGYWHSRMFLKPSAVPT
NT seq 4242 nt   +upstreamnt  +downstreamnt
atgaaggtccttgtgaagaaggtgcagcaggcgctctacgtcctgctgccgtgtgtactc
cagctctgctgcgctcagactcaaggagtgaccgtttgtgacggcaccaagaactttctg
agcacgactgggaattcagagatccagtacaacttgatgaagacgaggtacaataactgc
gacattgtgatgggcaacctcgagatcaccatgatggaccacaccagagacttcagcttt
ctggagtctatcaaggaggtgacagggtacatcctttttgctatcaatgagttcagccgc
ctcccactgcaccacctgcgcatcatcagaggcagcacactgtatgaggaccagtatgcc
ttggctgtcatggtcaactatcagagggatggggagcatggccttcaagaactgggcctg
actcacctcacagagatcctcaggggaggagtgaagatcatccagaataagtatctgagc
tacgccccgctggtgaattggctggacatagtgaaggatggaacagcccaaattgtgata
gaggacaatgggcctgaaaagccttgtcacaaagcctgtggagacgtgccatgctggggt
ccaggaaatgacacatgccagatcttgacaaagaccgtgtgcgcccctcagtgtagtggc
cgctgctttggtagaaacccgagcgagtgctgccacgttgagtgtgctggaggttgcact
gggcccaaggatacagactgctttgcctgcaggaacttcaacaactcgggctcctgcgtg
cctcagtgcccacaaactgtgatctacaacaggcttacatatagaatggagcccaacccc
aatgccaagtaccagtacggctctatttgtgtgacccaatgccccaaaatctttgtggtg
gatggcagttcatgtgtgagcaactgcccatctaataaaatggaagtggagaaaaatggt
gtgaaaacatgtgagccctgcaaaggcctctgccctaaagtttgccatggcacaagctgg
actgattcaaacagcgaaacggtcgatgctcgcaacatagaaagtttcataaactgcact
aagatccagggaagtcttaacttcctggtgacgggaatagaaggtgatgcctacaacaag
gtaccaccccttgatccagaaaaactgaaaatcttcaacacggtggaggagattacagac
ttcctcaacatccagtcgtggcctgcaagcatgtctgacctgtcagtcttctccaacctc
caaacaattcagggaagaaaactttacaaaggagtgattagtaaaaggagctatgcactc
atggtggttaagatcaattctctgacctcgctggggttgcgctcgctgcaaaacataaat
gatggtgccgtgtacattaaaggaaacaagaatctctgctatcatgatactgtcaactgg
acacggcttttaggctcccgtccacagaaacgttcaaagctcttagacgtcaccgacaac
caaaagaaggatgaatgtgttaaagagaagcatgtgtgtcacccgctgtgctcctctgat
ggctgctggggtccgggcccagaccagtgtgtcagctgtaagaaatacagcaggggagga
acctgtgtaccagactgcatgttcttaactgggaagcagagggagtttgctactaagtca
ggggagtgtctgccctgtcaccctgagtgtaaggtccaggaggggaaggagacgtgcaca
ggcccgggagcaaataaatgtctagcttgtgccagcctgaaagatggcccacactgtgtc
tccatgtgtcctgagggtgttatggggcaggagggaaccatctttaaatatccagacaag
gagggcaactgtaaaccttgccacaacaactgtacccagaggtgcaccggtccaggaatc
ggggactgtacaatatcatctaggtacatttcagggcaaatgaccacggctatcgtactg
ggagtgattgccctcatctttgcttccttctccattttcgtgctaagtattctctaccgc
cgaagtctcgctattcgtcgcaagcgcgccatgagaagatacatgatgaatagcgaaagt
tttgagcccctggaagataaagggacaaaatatgaagctcggacccttaaacctacagag
ctgcgtaagatcaggctcctgggtaatggagtgtttggatcagtccataagggtgtttgg
attcctgaaggcgacacagtgaagcttcctgtggccattaagacgattgatgaccgcagt
ggtcgtcggaaattctctggagtgaccgatcacatgaggacgatggcaagtctgaaccac
attaacgttgtcaggaccctgggtatctgtcccggtgacagcctgcaacttgttatcccg
ctcaacaggcaaggctcgctgctggcacatgtaaagaaaaataagggcaagctcagccca
cagaggctgctcaactggtgtgttcaaattgcaaagggtatgaattacctggaagagaac
aggatggttcacaggaatctggctgccagaaatgtactcctgaatgataatttcactgcc
caggtttcagactatggcattgcagacctgctctactctgatgacaagaagtactattgc
aacgagcccaagacaccaatcaggtggatggccctggagagcatcttgttccgcagatac
actcatcagagcgatgtttggagttatggtgtgacaatatgggaaatgatgtcttatgga
gcagagccgtattcaacgatgcgaccacaggaggttcccgatctgctggaaaagggcgag
cgtttgccccagcctcaaatttgcaccatagatgtctatatggtcatggttaagtgttgg
atgattgatgagaatgtccgtccaacattcaaggagctggcgagtgaatttaccagaatg
gccagagacccacctcgctacttggtgatcaaagaggactgtagccaacaggactcatcc
ccagatgaacccatccaacgaagtgcagacctggatgacttggatgatgtagatgtcaac
cttgaggacccgttggcagatgagaaagaagatgacttgtctccagccaactactacatg
gcaaaaagtctcaatcgttactctaggatggacactcccaaagtgattcttaattcatcc
agcggaactggatacctgcccatgacctcaggtgttgacaaccatacacaggcgatgtgg
cagtcacgctctcggctaaattctgcccgtactgtgtccgagagctcggaaggctgcggc
actggaatggagatggagatgggtgaggacttccccttagcagggagcctgaaaagaaga
cgtcatcgtgaggacagcgcttatgtgtcgcagagagacagcatgtccggcgggccacct
gagactccctcaccagagatggaagaagaagatcaaaacggatatgtgcttcctggaggg
agcccggagagagatacgttgcttttctcatcgcgagctgctcctgggaggatgggaaag
tctcgttcatcagagctcctggacgacccagatgatgaagaatacgagtacatgaacaag
caggtgtgtttaacacctgtatcactcaggcaaggcagccagtggctgaagccgaacaag
aagcgaacctcttcaatgtcatcacacgtgacagcgtcctcatgtgacaccggtgtgtcg
gtggaggtcaggggaagctacaccaggagcaaggacaactctgactccgagcagcagggt
tccagtgaagttgagtatgaatacatggacatcagaggcggtgaaaagctggaaggtccg
ccagtacgtgaccctcctcctcctccagctcctgtgaggatgagcagcaaggtggaagag
gaggaggatgaatacgtggaggacggtaactatcattacacaaacaggcagccaaagcta
cgacaggctcttcaagacaagaaagagctgaatgtagaggggacagaggcagatgaatac
gaggatatggactgcttttctgccccaccacctggcggagatggtgtggtgtatcaaaac
ttacagagggaggaaaatggggcagcggggcgcagagagcaacaccagtctatgcgggcc
ggagtcagggttacggagcctgctgtcggtgacagatctttcgacaacccaggatactgg
cacagcaggatgtttcttaagcccagtgctgtgccaacatga

DBGET integrated database retrieval system