KEGG   Maylandia zebra (zebra mbuna): 101465135
Entry
101465135         CDS       T02814                                 

Gene name
cbl
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL isoform X2
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04120  Ubiquitin mediated proteolysis
mze04144  Endocytosis
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101465135 (cbl)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101465135 (cbl)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101465135 (cbl)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101465135 (cbl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101465135 (cbl)
   04121 Ubiquitin system [BR:mze04121]
    101465135 (cbl)
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101465135 (cbl)
Membrane trafficking [BR:mze04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101465135 (cbl)
Ubiquitin system [BR:mze04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    101465135 (cbl)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-C3HC4_2 zf-RING_5 zf-C3HC4_4 zf-rbx1 zf-ANAPC11
Other DBs
NCBI-GeneID: 101465135
NCBI-ProteinID: XP_004543802
LinkDB
Position
LG14
AA seq 867 aa
MAGNLKKGGGIIGMMKDAFQPHHHHLHSHHQPGAVDKKTVEKCWKLMDKVVRLCQNPKLA
LKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGDNEYFRVFMENLTKKTKQTISLFKEG
KERMYEENSQPRRNLTKLSLIFSHMLAELKAIFPNGLFQGDNFRITKADAAEFWRRAFGD
KTIVPWKVFRQSLHEFHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLR
NWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQ
TIPHNKPLFQALIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGS
TFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGTGCPFCRCEIKGTEPIVVDPF
DPKDNSGGSSKSTFGAEGAPSPSYDDDDDDRLEDPHLIMSKLACTKVERPPSPMSGTPQS
SLPPVPPRLDLLPHRPPNPPGASSPGVSSKAPSHHKDKPLPLPPALRDLPPPPPPDRPHT
AGAAPDGRLQRRPLPSTPGEPPRDKLPPTPPNRPLSDWTSRPVPKAPTSSSSSSSVSSSS
TQFPCLGGDLRAGVRELSNRHSLPLALPSAMDARSDSQNNSSLSLDHQLNFSTGVGQDYD
NPRVKPSVSANAIYALANRASPATARPAGGDEGHDSDDEYMIPSSRPVLPPIPTPLMGET
PPIPRPPQPVSAVPTQTQASALNTRLILDDVPHSLQMYEAMFNAQPRSQQARDSDYSDLP
PQPVSNGPRDHEADDGEEEENGYDFPKPRLPLPPARRTLSEMGGSLSSSSSSSSLCAAAA
FNRLSLDADAGATAPMSSEWWKQPDVG
NT seq 2604 nt   +upstreamnt  +downstreamnt
atggctgggaacctgaagaaaggcggggggatcatcggaatgatgaaggatgccttccag
ccacaccatcaccacctccactcccatcaccagcccggggccgtggacaaaaagacggtg
gagaaatgctggaaactaatggacaaggtggtgcggctatgccaaaaccccaaactggct
ctgaagaacagccctccctacatcctggacctgctgccagacacctaccagcacctgcgc
accattttgtctcgttacgagggcaaaatggagactttgggtgacaatgagtatttccgg
gtcttcatggagaacctgacaaagaagaccaagcagaccattagcttgttcaaggagggc
aaggaacgcatgtatgaggagaattcacaaccaaggaggaatcttaccaagctgtctttg
atcttcagccacatgctggctgagctgaaggccatcttccccaatggtctgtttcagggt
gacaacttccgcatcactaaggcagatgctgcagagttttggagacgcgccttcggggat
aaaaccattgtgccttggaaggtattccgtcagtctctccatgagtttcatcccatcagc
tctgggctggaggctatggccctaaagtccaccatagatctaacctgcaatgactacatc
tccgtctttgagtttgacatattcaccaggctatttcagccttggtcatccctgctgcgg
aactggaacagcttggcagttactcacccggggtacatggccttcctcacctacgatgag
gtcaaagctcggcttcaaaagttcattcacaagcctggcagttacatcttccgactgagc
tgcacaagactgggccagtgggctattggctacgtgactgcagatggaaatatactccag
accattccccataataaacccctcttccaggctctcattgatggtttcagggaaggattc
tatttattccctgatggccggactcaaaatcctgacctgacaggactgtgcgagccttcg
cctcaagaccatatcaaagtcacccaggaacaatacgagctgtactgtgagatgggctcc
actttccagctttgtaagatctgtgccgagaacgacaaggatgtgaagattgagccctgt
ggtcatctcatgtgcacttcctgtctcactgcctggcaggagtcagaaggtcagggaaca
ggatgtcccttttgtcgctgtgagattaagggtacggagccgatagttgtggatcctttt
gacccaaaggacaacagcggagggtcttccaagagcacatttggggctgagggtgcaccc
tcacccagctacgacgacgatgatgatgacagacttgaagaccctcatctaataatgagc
aaacttgcctgcacaaaggtggagcgtcccccatcacctatgtctgggactcctcagtcc
tctcttcccccagtgcctcccagactagacctattaccgcacagacctcccaacccccct
ggtgcctccagccctggagtcagcagtaaggcaccatctcatcacaaagacaagcctctt
ccccttcccccagcactgcgtgatctcccccctccccctcctccagaccgtccccacaca
gccggggcagcccctgatggacggcttcagaggcggcccttgcccagcacacccggggag
ccccctcgcgataaactccctcctacacccccaaaccgacccctgtctgactggacctcc
aggccggttcccaaggctcccacctcctcttcgtcatcctcttcggtatcctcttcgtcc
acccagttcccctgtctgggcggggacctccgagcaggtgtcagggaactctccaacagg
cactccctccccttggcactgccctccgccatggacgctcgctcagactcccagaacaac
agctccctcagtctggaccaccagctgaatttttccacgggagttggtcaagattacgac
aaccccagagtcaaaccttctgtctcagccaacgccatttatgcactggcaaacagagcg
tccccagctacagccaggccagcaggaggagatgaaggacatgacagtgatgatgagtac
atgatcccctcttctcggcccgttctgccccccatcccgactccactcatgggggagacc
ccaccaatcccaagacccccacagcccgtgtcagcagtcccgacacagacccaggcctct
gcactgaacacacggctgattctggacgatgtacctcattcactccaaatgtatgaagcc
atgttcaacgcccagcccaggtcacaacaagcgagagattcagactattcagatttgccc
cctcaaccagtgagtaacggtcccagagaccatgaggctgacgacggggaagaggaggag
aacggctacgacttcccaaaaccccgactgcctttgcctcccgcccgacggaccctttca
gaaatgggggggtctttgtcttcatcttcttcatcctcctcattatgcgctgcagcagct
ttcaatcgtctttctctagatgcggatgctggagcgacagcaccgatgtcctcagaatgg
tggaaacaacctgatgtgggatga

KEGG   Maylandia zebra (zebra mbuna): 101471367
Entry
101471367         CDS       T02814                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase CBL
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04120  Ubiquitin mediated proteolysis
mze04144  Endocytosis
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101471367
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101471367
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101471367
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101471367
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101471367
   04121 Ubiquitin system [BR:mze04121]
    101471367
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101471367
Membrane trafficking [BR:mze04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101471367
Ubiquitin system [BR:mze04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    101471367
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-RING_4
Other DBs
NCBI-GeneID: 101471367
NCBI-ProteinID: XP_004573538
LinkDB
Position
LG10
AA seq 861 aa
MAGNPRRGAGLIGLMKDAFQPHQQALQPHQPAVVDKKMVEKCWKLMDKVVRLCQNPKVAL
KNSPPYILDLLPDTYQHLRTILSRYEGKIEILGENEYFRVVIDNLTNKTKQTMSLFKEAK
ERMYEENSQPRRNLTKLSLIFSHMLAELKAIFPNGLFQGDNFRITKADAAEFWRRSFGDK
TIVPWRTFRQALHEFHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRN
WNSLAVTHPGYMAFLTYDEVKARLHRFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQT
IPHNKPLFQALIDGYREGFYLFPDGRAQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGST
FQLCKICAENDKDVKIEPCRHLMCTSCLTAWQESEGQGCPFCRCEIKGTEPIVVDPFHPK
ASGASFAGFQGSSRAEAAGNEEEEDDRLEDQQLVMSRLACTKVERPPSPVSQLPPVPPRL
DLLQQRSSASLSALSQGATAKMVATHRDKPLPLPPALRELPPPPPPERPSLVGQESRLQR
RPLPSTPDQPAWAANYMVPRPATKAPSSIPQSNGAGAEGSKPQTAINAVYCLAALRSLPG
SAVSSGEKLSSDGEDNEYMSPTSLPASGAPWVITGSLVPPPPTQGNNHNDISEVGDSDSE
DPQVYESMCNIQAQAGSSETTQNSELDLPQHSAVPPDKKEEASVEDVYEYDFPRPVVPPA
PARRALSDIGGPSSAFSNLNIDSAVDPSMFVAGDDPERPLKPLPQRANSDRRPRPLNRKP
PPPPPDLPGPSSSASPVPPPTIPPSGPGSLALNGEIECLISQGYSIQDIQKALMIAQNNL
ETAKNILREFVSIPSTAHIAT
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggccggaaatccgagaaggggcgccggtctcatcggcttgatgaaggacgcctttcag
cctcaccagcaagctctccagcctcaccagcccgcagtggtcgacaagaaaatggtggaa
aaatgctggaaactcatggataaggtggtacgtctgtgccagaaccccaaggtggcgttg
aagaacagcccgccctacatcctggaccttttgccggatacctaccagcatttacgcacc
attctgtccaggtatgagggcaaaatagagatcctcggcgagaatgagtatttccgcgtg
gtcatcgacaacttgacgaacaagacgaagcagaccatgagcctttttaaggaggccaag
gagaggatgtacgaggagaactcccagcccaggcgaaaccttaccaagctgtctctgatc
ttcagtcacatgctagcggagttaaaagccatcttccccaatggcctatttcagggtgac
aacttcaggattaccaaagctgatgctgctgaattctggagaaggtcattcggggacaag
actatagtgccatggaggacatttcggcaggctcttcatgagtttcaccctattagctca
ggtctggaggccatggcgctcaaatccactatcgacctcacctgtaacgattacatctct
gtcttcgagtttgacatctttacaaggctctttcagccatggtcatctcttctaaggaac
tggaacagcctggctgttacacaccctggttatatggccttcttaacctacgatgaggtg
aaggctcgactgcacaggttcatccacaaacctggcagctatatcttcaggctgagctgc
actcggctgggccagtgggcaattggctatgtgacagctgatgggaacatcctgcagacc
atcccgcataacaaaccactcttccaagcactcattgatggatacagagagggattctat
cttttcccagatggccgtgcacagaacccggacctgacagggttgtgtgaaccgtctcca
caggatcacatcaaagttactcaggagcagtacgaactctactgcgagatgggctctact
ttccagctttgtaagatctgtgcagagaacgacaaggatgtgaagatcgagccgtgcaga
cacctgatgtgcacctcgtgtctgaccgcctggcaggaatcggagggtcagggctgcccg
ttttgccgatgtgagattaaaggcacggagcctattgtagtggacccctttcacccgaag
gccagtggggcttcctttgctggtttccaggggtcgagcagagcagaagccgcaggcaac
gaagaggaagaggatgatcggctggaagaccagcaacttgtcatgagcaggctggcctgc
accaaagtggagcgccctccatctccagtgtctcagctgcctccggtgcctccgcgactg
gacctcttacagcagaggtcctctgcctcccttagtgcactgagtcagggagccacagcc
aaaatggtagccactcacagggacaagcctctacctctgcctccagcactgagagagctg
ccccctcctcccccaccggagcgcccctccctggtcggccaggaatccagactccaaagg
agacccctcccctccaccccggaccagccagcctgggcagccaactacatggtgccacgc
cctgcaacgaaggccccgtcgtccatccctcagagcaacggagccggcgcagaggggagc
aaaccgcagacggcgatcaatgctgtgtactgcctggctgcactaaggtcgttgccaggg
tcagcggtgtccagcggggagaagctgtcgtcagacggtgaagataatgagtacatgagt
cccacatcccttccagcttccggtgccccgtgggtaataacaggctccttggtgccccca
ccaccaacccagggaaacaaccacaatgacatcagtgaggtgggggacagtgactctgag
gacccccaggtttacgaatccatgtgtaacatccaggcccaggccggctcgtcggagacg
acacagaactctgagctggaccttcctcagcattcagctgttccgccggacaaaaaggag
gaggccagtgtggaggatgtttacgagtatgactttcccagaccagtggtccctcctgcc
cccgccagaagagccctgtcagatatcggcggcccttcttcagccttcagtaatctcaac
atagactctgcagtagatcccagtatgtttgtagcaggcgacgaccccgaacgtccccta
aaacctctcccgcagcgagctaactctgaccgacggcctcgtccgttaaaccgcaagcca
cctccgccgccgccagacctccctggcccctcctcatctgcctcccctgttccacctccg
actattcctccttcaggtcctggaagcttggccctaaacggggagattgaatgcctcata
tcccaaggctactccatccaggacatccagaaggccctgatgatcgctcagaacaacctc
gagacggccaagaacatcctgcgcgagtttgtctccatcccttccacagcgcacatcgcc
acatag

KEGG   Maylandia zebra (zebra mbuna): 101484242
Entry
101484242         CDS       T02814                                 

Gene name
cblb
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-B isoform X2
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04120  Ubiquitin mediated proteolysis
mze04144  Endocytosis
mze04625  C-type lectin receptor signaling pathway
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101484242 (cblb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101484242 (cblb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101484242 (cblb)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101484242 (cblb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101484242 (cblb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101484242 (cblb)
   04121 Ubiquitin system [BR:mze04121]
    101484242 (cblb)
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101484242 (cblb)
Membrane trafficking [BR:mze04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101484242 (cblb)
Ubiquitin system [BR:mze04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    101484242 (cblb)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5
Other DBs
NCBI-GeneID: 101484242
NCBI-ProteinID: XP_004575138
UniProt: A0A3P9DBJ4
LinkDB
Position
LG10
AA seq 935 aa
MATALSSRYPGGRGPNRSKGRILGIIDAIQDAVGPPKQAVADRRTVEKTWKLMDKVVRLC
QNPRLQLKNSPPYILDILPDAYQHLRVILGKYEENQMIIQLSENDYFKIYIDSLMKKSKR
AIRLFKEGRERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPGGQFQGDTFRITKADAAD
FWRRFFGEKTIVPWKVFRQCLHDIHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLHKYINKPGSYIFRLSCTRLGQWAIGYV
TTDGNILQTIPNNKPLFQALIDGYKEGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDIKIEPCGHLMCTSCFTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRNEGSKCFFLDQHSSPLLDLDDEEDREDCLVMNGLANIRKQCGEHQKSPMVS
PSSSPVSQHRKAHGGNSSQCVQHLSLPPVPPRRDLINKGAIRSPSASPICSPKSSPGISR
KQDKPLPAPPPPQRDPPPPPPPERPPPVPPESHHSSLPSSSYMSSSSTGMLSEFQISSET
WCSKDSHLTDAHKTGGEHQLQLGPTVPCHLHRRPLSCPSVEFVRLHQRLDGAGNSESSKP
FCNGEQVSDEYDIVPSRQLPTQSKLCSSHKSSNPFCSPVLEQHQGAMEGPEGNYHIPSSS
LCLSQTPVCITVASRSLENSPPELSFEEEKPWCLEPVFEDTLNSCPPSQPPPPPVRHSFT
EPPSSPSSCNSSMSSNSVITQLHMPPSGHEHVLLTPDSVFGMVNSAAPSHPAKRQTDNVK
SSRGILEYNHPVSLDCLQAPARPPKPYPRKIPPEIQPEKPHSLELESEDAKIAKLMGEGF
AFDDVKRALMIAQYKVDVARNILREFALVAPRLNL
NT seq 2808 nt   +upstreamnt  +downstreamnt
atggcaactgctctcagtagtcgatatcctggtggacgtggaccaaatagaagtaagggg
cgaattttaggcatcattgatgccatccaggatgcagtggggccacccaaacaagcagtt
gctgaccggaggactgtagaaaaaacttggaaactcatggataaagttgtgcggctctgc
caaaatcccagactccaactgaaaaacagtccaccatatatcctggatattttacctgat
gcctaccaacacctgcgggtcatactaggcaaatatgaagagaaccagatgatcatacag
cttagtgagaatgattactttaaaatctacattgatagccttatgaagaaatccaaacga
gctatccggctcttcaaagagggaagagagaggatgtacgaggagcagtcacaggacagg
aggaacctgaccaagctgtctctgatcttcagtcatatgctggcagaaatcaaggcaatc
ttccctggaggacaattccaaggagacacgttcaggattaccaaagctgatgctgctgac
ttctggaggagattttttggtgaaaagacaatagtgccatggaaagtcttccgtcagtgc
cttcatgacatacatcccatcagcagcggtctggaggctatggctctcaaatccaccatt
gacctcacctgcaatgactacatttctgtgttcgagtttgacatcttcacacgcctcttc
cagccttggggatcgattctgaggaactggaatttcctagcggtgacacaccctggctat
atggccttccttacttatgatgaagtcaaagctcgactgcacaagtacatcaacaagcct
ggcagttacatcttcagactgagttgtacacgtttgggccaatgggccattggctatgtg
accactgatggaaacatactgcagaccattcccaacaacaaaccgctgttccaggcttta
atcgatggctacaaggagggcttctacttattcccagatggtcgcagttacaatcctgac
ctcactggtttatgtgagccgacacctcacgatcacatcaaagtcacacaagagcagtat
gagctgtactgtgaaatgggctctacctttcagctttgtaagatctgtgctgagaatgac
aaagacatcaagattgaaccatgcggtcacctcatgtgtacttcctgttttactgcctgg
caggaatcagatggccaaggatgccctttctgtcgctgtgagatcaaaggcacagagccc
attattgtggatccctttgacccacgaaatgagggctccaagtgcttcttcctggaccaa
cacagctcccccttgctggacctggatgatgaggaagaccgagaagactgtcttgtcatg
aatggactggccaacatcaggaagcaatgtggtgagcatcagaaatcgccaatggtgtcg
cccagttcttcacctgtcagccaacacagaaaagcccatgggggaaactccagccaatgt
gtccagcacctcagcctcccacctgtcccaccacgacgtgaccttatcaacaaaggtgcc
attcgctccccatctgccagtcccatctgctcccccaagtcttcaccaggcatatctagg
aagcaagacaagcctcttccagccccacctcctccacagagggacccaccaccacctcct
cctcccgagcgtcctcctcctgtcccccctgaatcacaccactcttcgctccccagttcc
tcgtacatgtcctcttcttctacaggcatgctgtcagaattccaaatttcctctgagact
tggtgctccaaagacagccatttgacagatgcacacaagactggaggggaacaccaactc
cagctgggacccactgtgccttgtcacttgcaccgaagaccactcagttgtccatctgtg
gaatttgtgaggttacatcaaaggttggacggggcaggaaattcagagagctccaagccc
ttctgtaatggcgagcaagtcagtgatgagtatgacatcgttccctcacggcagttgcca
actcagtccaaactttgtagtagccacaaatcctccaaccctttttgcagccctgtgtta
gaacaacatcaaggggcaatggaaggaccggagggcaactatcacattccttcatccagt
ctgtgcctgagtcagactcctgtctgcatcactgtagcaagcaggtccttggaaaatagc
cctccagagctgtcctttgaggaggagaagccctggtgccttgagcctgtatttgaagac
accttaaacagctgccctccatcccagcctcctcctccacctgtgagacacagctttact
gagccgccctcatcaccctcatcctgtaactcttccatgtcatccaactctgttatcact
caactacacatgcccccctctggacacgagcatgtcctgttaactccagactcagttttt
ggaatggtgaacagtgctgctccctcgcatccagccaaaaggcaaacggacaatgtgaaa
agctccagaggcatcctggagtacaaccatccagtatcactggactgtttgcaggcacca
gcgaggccacccaagccatatccgaggaagattcctccagaaatacaaccagaaaaacca
cacagcctggagctggagagtgaagatgcaaagatagctaaactgatgggcgagggtttc
gcttttgacgatgtgaagcgagcactgatgattgctcagtacaaagtggatgtggcccga
aacatcctgcgagaatttgccttagtggcccccagactcaacctctag

KEGG   Maylandia zebra (zebra mbuna): 101484693
Entry
101484693         CDS       T02814                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-like
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04120  Ubiquitin mediated proteolysis
mze04144  Endocytosis
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101484693
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101484693
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101484693
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101484693
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    101484693
   04121 Ubiquitin system [BR:mze04121]
    101484693
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101484693
Membrane trafficking [BR:mze04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101484693
Ubiquitin system [BR:mze04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    101484693
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2
Other DBs
NCBI-GeneID: 101484693
NCBI-ProteinID: XP_024656495
LinkDB
Position
Unknown
AA seq 775 aa
MAGNPRRGTGLIGLMKDAFQPHQPAVVDKKMVGKCWKLMDKVVRLCQNPKVALKNSPPYI
LDLLPNTYQHLRTILSRYEGKIEILGKNEYFRVVIDNLTNKTKQTMSLFKEAKERMYEEN
SQPRQNLTKLSLIFSHMLAELKAIFPNGLFQGDNFRITKADAAEFWRRSFGDKTIVPWRT
FRQALHEFHPISSSLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLGVT
HPGYIAFLTYDEAKARLHRFIHIPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPL
FQALIDGYREGFYLFPDGRAQNPDLTGLCEPSPQDHIKVTQVCFSCACRQGSSFSCCRIF
FKNDESFSQLLCLYLLTLLCLSVCAFQESEGQGCPFCRCEIKGTEPIVVDPFHPKATGAS
FAGFQGSSRAEAAGNEEEEDDRLEDQQLIMIWLACTKVERPPSPVSQLPPRLDLLQQRSS
TSHSALSQGATVKMVATHRDKPLPLPPALREPPPPLPPERPSLVGQESRLQRRPLPSTPD
QPAWAANYMVLRPTTKAPPQQGYMALEVGDSDSEDPQVYESMCNIQAQAGSSETTQNSEL
YHPQHSAVPQDKKEEASVEDVYEYDFPRPVVPPAPARRALSDIGGPSAAFSNLNIDSAVD
PSMFVAGDDPERPLKPLPQRANSDRRPRLLNRKPPPPPPDLPGPSSSASPVPPPTIPPSG
PGSLALNGEIECLISQGYSIQDIQKALMIAQDNLETAKNILREFVSIPSTAHIAT
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggccggaaatccgagaaggggcaccggtctcatcggcttgatgaaggacgcctttcag
cctcaccagcccgcagtggttgacaagaaaatggtgggaaaatgctggaaactcatggat
aaggtggtgcgtctgtgccagaaccccaaggtggcgttgaagaacagtccgccctacatc
ctggatcttttgccgaatacctaccagcatttacgcaccattctgtccaggtatgagggc
aaaatagaaatcctcggcaagaacgagtatttccgcgtggtcatcgacaacttgacgaac
aagacgaagcagaccatgagcctttttaaggaggccaaggagaggatgtacgaggagaac
tcccagcccaggcaaaaccttaccaagctatctctgatcttcagtcacatgctagcggag
ttaaaagccatcttccccaatggcctatttcagggtgacaacttcaggattaccaaagct
gatgctgctgaattctggagaaggtcattcggggacaagaccatagtgccatggaggaca
tttcggcaggctcttcatgagtttcaccctattagctcaagtctggaggccatggcgctc
aaatccactatcgacctcacctgtaacgactacatctccgtcttcgagtttgacatcttt
acaaggctctttcagccatggtcatctcttctaaggaactggaacagcctgggtgttaca
caccctggttatatagccttcttaacctacgatgaggcgaaggctcgactgcacaggttc
atccacatacctggcagctatatcttcaggctgagctgcactcggctgggccagtgggca
attggctatgtgacagctgatgggaacatcctgcagaccatcccgcataacaaaccactc
ttccaagcactcattgatggatacagagagggattctatcttttcccagatggccgtgca
cagaacccagacctgacagggttgtgtgaaccgtctccacaggaccacatcaaagttact
caggtttgtttctcatgtgcgtgcagacagggatcttctttttcctgctgtagaattttc
tttaaaaatgatgaaagcttcagtcagctcctttgcctttacctcctaaccttgctgtgt
ctttccgtgtgtgcatttcaggaatcggagggtcagggctgcccgttttgccgatgtgag
attaaaggcacggagcctattgtagtggacccctttcacccaaaggccactggggcttcc
tttgctggtttccaggggtcgagcagagcagaagccgcaggcaacgaagaggaagaggat
gatcggctggaagaccagcaacttatcatgatctggctggcctgcaccaaagtggagcgc
cctccgtctccagtgtctcagctgcctccgcgactggacctcttacagcagaggtcctcc
acctcccatagtgcactgagtcagggagccacagtcaaaatggtagccactcacagggac
aagcctctacctctgcctccagcactgagagagcctccccctcctctcccaccggagcgc
ccctccctggtcggccaggaatccagactccaaaggagacccctcccctccaccccggac
cagccagcctgggcagcaaactacatggtgctacgccctacaacgaaggccccaccacaa
cagggctatatggcgcttgaggtgggggacagtgactctgaggacccccaggtttacgaa
tccatgtgtaacatccaggcccaggccggctcgtcggagacgacacagaactctgagctg
taccatcctcagcattcagctgttccgcaggacaaaaaggaggaggccagtgtggaggat
gtttacgagtatgactttcccagaccagtggtccctcctgcccccgccagaagagcccta
tcagatatcggcggcccttctgcagccttcagcaatctcaacatagactctgcagtagat
cccagtatgtttgtagcaggcgacgaccccgaacgtcccctaaaacctctcccgcagcga
gctaactctgaccgacggcctcgtctgttaaaccgcaagccacctccgccgccgccagac
ctccctggcccctcctcatctgcctcccctgttccacctccgactattcctccttcaggt
cctggaagcttggccctaaacggggagattgaatgcctcatatcccaaggctactccatc
caggacatccagaaggccctgatgattgctcaggacaacctcgagacggccaagaacatc
ctgcgcgagttcgtctccatcccttccacagcgcacatcgccacatag

DBGET integrated database retrieval system