KEGG   Maylandia zebra (zebra mbuna): 101465176
Entry
101465176         CDS       T02814                                 

Gene name
nck2
Definition
(RefSeq) cytoplasmic protein NCK2
  KO
K19862  NCK adaptor protein 2
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101465176 (nck2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mze04990]
    101465176 (nck2)
Domain-containing proteins not elsewhere classified [BR:mze04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   101465176 (nck2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 101465176
NCBI-ProteinID: XP_004551347
UniProt: A0A3P9D6F9
LinkDB
Position
LG16
AA seq 398 aa
MTEEVIVVAKWDYTAQQDQELDIRKNERLFLLDDSKTWWRVRNASNQTGYVPSNYVERKN
SLKKGSLVKNIKDTLGLGKTKRKTSARDASPTPSSDTEYPSNGSGGGGVGVGAAERIYDL
NIPATVKFAYTAERDDELTLVKGSRVIVMEKCSDGWWRGNQVGRVGWFPSNYVQEELGGS
DDRGEGDSSRGYLEASQGTLLANGRTGGRGGVLHLVQTLYPFSSVTEEELNFEKGEVMEV
VEKPENDPEWWRCKNSRGMVGLVPKNYVAMLDERPGPPSSTSSSPQNRLLAPARSGRFAG
RDWYYGNITRHQAECILNEKGEEGDFLIRDSESSPSDFSVSLKAVGKNKHFKVQLSDGVY
CIGQRRFNSMDELVEHYKKAPIFTSEHGEKLYLVKALL
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacagaggaggtgattgttgtagccaagtgggactacacggcccagcaggaccaggaa
cttgacatccgtaaaaatgagcgtctcttcctcctggacgactcgaagacctggtggcgt
gtccgcaacgcctccaatcaaacgggatatgtgccatcaaactacgtcgagcgcaagaac
agcctgaagaagggctcacttgtgaagaacatcaaagacactctgggtttaggaaaaact
aagaggaagacgagtgcccgagatgcttccccaacaccaagctcagacacagagtacccc
tccaatggcagtgggggtggaggagttggggtaggagcagcagagagaatctatgacctc
aatatccctgctacagttaagtttgcctacacagcagagagggatgatgagctgaccctg
gtgaaaggctccagagtgatcgtgatggagaagtgcagtgacggctggtggcggggcaat
caggtggggcgggtaggctggtttccctccaattacgtccaagaggagctcggagggtca
gatgatagaggggagggcgattcctcgcggggatacctcgaagcttctcaaggaactttg
ttggcaaacgggcgcacaggtggccgtgggggagttcttcacctggttcagactctctac
cccttcagctctgtgacagaggaggagctaaactttgagaagggagaagtcatggaagtg
gtggagaagcccgagaacgacccagagtggtggaggtgtaaaaactcacgtggcatggtg
ggcctggtacctaaaaactatgtggcgatgctggacgagcggcctggcccgccctcctct
acgtcgagctccccacagaaccgcctcctggcaccggcacgctcagggaggttcgctggc
agggactggtactacggcaacatcaccagacaccaggctgagtgcatactcaacgagaaa
ggcgaagagggtgacttcctcatacgagacagcgagtcatcgcccagtgacttctccgtg
tctctgaaggcggtgggtaagaataagcactttaaagtgcagctgtcagacggagtgtac
tgtattggccagcgcaggtttaactccatggatgaacttgtggagcattacaagaaagct
cccatcttcaccagcgaacatggggagaagctgtacctggtcaaagcactgctgtga

KEGG   Maylandia zebra (zebra mbuna): 101479403
Entry
101479403         CDS       T02814                                 

Gene name
nck1
Definition
(RefSeq) cytoplasmic protein NCK1 isoform X1
  KO
K07365  NCK adaptor protein 1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101479403 (nck1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mze04990]
    101479403 (nck1)
Domain-containing proteins not elsewhere classified [BR:mze04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   101479403 (nck1)
SSDB
Motif
Pfam: SH3_9 SH3_1 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 101479403
NCBI-ProteinID: XP_004546825
UniProt: A0A3P9CPG0
LinkDB
Position
LG9
AA seq 392 aa
MTEEVIVIAKFDYMAQQDQELDIKKNERLWLLDDSKSWWRVRNATNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKSRKGGMRDPAPNADPDMNADNGERLYDLNLPALVKFSYT
AEREDELSLVKGTRVVVMEKCSDGWWRGSYSGRSGWFPSNYVTEDVDGTAGGGGMGGLDP
AGSLTEKLAAVVNITANGNRVLHTVQALYPFSSGNDEELNFEKGEVMEVVEKPENDPEWW
KCRKADGQLGLVPKNYVTVLDSTSHKPQAGLAGPPTPECDYILPSGSGRFAGKEWYYGKV
TRHQAEVALNQRGTEGDFLIRDSESSPNDFSISLKAQSKNKHFKVQLKDNLYCIGQRKFN
SMEELVEHYKKAPIFTSEQGDKLYLIKALAAS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgacggaagaggtgattgtcatcgccaaatttgactacatggcccagcaggaccaggag
ctggacatcaagaaaaacgagcgtctctggcttctcgatgactcaaagtcctggtggagg
gttcgaaatgccaccaacaaaacaggctttgtgccgtccaactatgtggaaaggaaaaac
agtgccaggaaagcatctatagtcaagaatctcaaagacacactaggaattgggaaagtg
aagagcagaaaggggggtatgagagatccagcccctaatgctgacccagatatgaatgca
gataacggagagaggctgtatgacctcaaccttcccgccctggtcaagttcagctacaca
gcagagcgtgaggatgagctgtctctggtgaagggaacacgtgtggtggtgatggagaag
tgcagcgacggctggtggcgcggtagctacagcggacggtcaggttggtttccgtccaac
tatgtgacggaggacgtggatgggacggcggggggagggggtatgggcggactcgaccct
gccggatcgctgacagagaaactggctgcggtggtgaacatcacagcgaacggaaaccga
gtgctgcacacagttcaggcgctctacccgttcagctcaggcaacgacgaggaactgaac
tttgagaagggcgaggtaatggaggtggtggagaagcccgagaatgacccggagtggtgg
aagtgccgcaaagcggatggacagctgggcttggtgcccaagaactacgtcactgtgctg
gactccacctcccataaaccgcaagcggggctcgctgggccgcccacacccgagtgcgac
tacatcttgccatcaggcagcgggcgctttgcggggaaggagtggtactacggaaaggtg
acgcgccatcaggcagaggtggcgctcaatcaaagaggcacagagggagacttcctcatc
cgagacagcgagtcatcgccaaacgacttttccatctccctgaaggcgcagagcaagaac
aagcatttcaaagtgcagctgaaggacaacctttactgcatcggacagcgcaagttcaac
tctatggaagagcttgttgaacactacaaaaaggctcccatcttcaccagtgagcaggga
gacaaactgtacctgattaaagccctggctgcttcctga

DBGET integrated database retrieval system