KEGG   Maylandia zebra (zebra mbuna): 101465184
Entry
101465184         CDS       T02814                                 

Gene name
map2k1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04114  Oocyte meiosis
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04270  Vascular smooth muscle contraction
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04620  Toll-like receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04916  Melanogenesis
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101465184 (map2k1)
   04012 ErbB signaling pathway
    101465184 (map2k1)
   04370 VEGF signaling pathway
    101465184 (map2k1)
   04371 Apelin signaling pathway
    101465184 (map2k1)
   04068 FoxO signaling pathway
    101465184 (map2k1)
   04150 mTOR signaling pathway
    101465184 (map2k1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101465184 (map2k1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101465184 (map2k1)
   04210 Apoptosis
    101465184 (map2k1)
   04218 Cellular senescence
    101465184 (map2k1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101465184 (map2k1)
   04540 Gap junction
    101465184 (map2k1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101465184 (map2k1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101465184 (map2k1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101465184 (map2k1)
   04912 GnRH signaling pathway
    101465184 (map2k1)
   04914 Progesterone-mediated oocyte maturation
    101465184 (map2k1)
   04916 Melanogenesis
    101465184 (map2k1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101465184 (map2k1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101465184 (map2k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101465184 (map2k1)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101465184 (map2k1)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE7 family
   101465184 (map2k1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 101465184
NCBI-ProteinID: XP_004553135
UniProt: A0A3P9D8E2
LinkDB
Position
LG7
AA seq 395 aa
MQKRRKPEPIQLNPIPDGNTINGSGATETNLEALQKKLEELELDEQQRKRLEAFLTQKQK
VGELKDDDFEKICELGAGNGGVVFKVSHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLH
ECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQSLKKAGKIPEQILGKVSIAVIKGLSY
LREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTH
YSVQSDIWSMGLSLVEMAIGRFPIPPPDAKELEQIFGFPVEGEAASSDSSPKPQPPGRPG
SSYGPDSRPPMAIFELLDYIVNEPPPKLPAVFSSEFQDFVNKCLIKNPAERADLKQLMVH
PFIKTSEAEEVDFAGWLCTTIGLSQPLTPTHGTIM
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgcagaagagaaggaaacctgagccgatccaactcaaccccatccctgatggaaacact
atcaacggcagcggagccacagaaacaaacttggaggcactgcagaaaaaactagaggag
ctcgagttggatgagcagcagcggaaacgcttggaggcctttctgacacagaagcagaaa
gtgggagagctgaaggacgatgactttgagaagatctgtgagctcggtgccggcaacgga
ggagttgtctttaaggtttcccaccgaccctcgggtctgattatggcaaggaaactgatc
caccttgagattaaaccagccatcaggaaccagatcattagggagctgcaggtgctacat
gagtgcaactccccatatattgtgggcttctacggggctttctacagcgatggggaaatc
agcatctgcatggagcatatggatggtggctccctggaccaatcactgaagaaagcaggc
aagatcccagagcagatccttggcaaagtcagcattgctgtaattaaaggtctttcctac
ctgagggagaagcacaagatcatgcacagagatgtcaagccttctaacatcctagtgaat
tcccgtggtgagatcaagctgtgtgactttggagtgagcggacagcttatagactccatg
gccaactcctttgtgggcactcggtcgtacatgtcgcccgagcgcttacaaggcacccac
tattctgttcagtcggacatctggagcatgggtctgtcactggttgaaatggccattgga
cgctttcctattccaccacctgatgctaaggagctcgaacagattttcggcttcccagtg
gaaggggaggcagcctccagtgattcctccccaaagccgcagccccctgggcgacccggc
agctcatacggcccagacagcagacctccgatggccatttttgagcttcttgattacatc
gttaacgagcctccaccaaaactgcctgctgtatttagttctgaattccaggactttgtt
aataaatgcttgattaaaaacccagcagagagagcagacttgaaacagttgatggtgcat
cctttcattaaaacctccgaagcagaggaagttgactttgctggctggctgtgcaccacc
attggactcagtcagcctttgacaccaacacatggtaccataatgtga

KEGG   Maylandia zebra (zebra mbuna): 101478402
Entry
101478402         CDS       T02814                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04270  Vascular smooth muscle contraction
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04540  Gap junction
mze04620  Toll-like receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101478402
   04012 ErbB signaling pathway
    101478402
   04370 VEGF signaling pathway
    101478402
   04371 Apelin signaling pathway
    101478402
   04068 FoxO signaling pathway
    101478402
   04150 mTOR signaling pathway
    101478402
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101478402
  09143 Cell growth and death
   04210 Apoptosis
    101478402
   04218 Cellular senescence
    101478402
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101478402
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101478402
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101478402
  09152 Endocrine system
   04910 Insulin signaling pathway
    101478402
   04912 GnRH signaling pathway
    101478402
   04916 Melanogenesis
    101478402
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101478402
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101478402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101478402
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101478402
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE7 family
   101478402
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 101478402
NCBI-ProteinID: XP_004552800
UniProt: A0A3P9BG99
LinkDB
Position
LG23
AA seq 399 aa
MGPKRKPGPLNITPIGEGQATSNTIDAASEANLEALQKKLGELDLDEQQRKRLEAFLTQK
AQVGELKDEDFEPICELGAGNGGVVNKVRHKPSGLVMARKLIHLEIKPAIRNQIIRELQV
LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGL
AYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQG
THYSVQSDVWSMGLSLVELAIGRYPIPPPDTRELEAIFGRAVVDGAEGEPHVNMQRPRPP
GRPISGSGMDSRPAMAIFELLDYIVNEPPPKLPLGVFTSDFQDFVTKCLIKNPAERADLK
MLMSHTFIKRSEVEEVDFAGWLCKTMGLNQPSTPTRGAE
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgggccccaaaagaaaacccggtccccttaatattacgcccattggagagggacaggcc
acctccaacaccattgatgctgcatctgaagccaacctcgaggccttacagaagaagctg
ggggagctggacctggatgaacagcagaggaaacggctggaagcctttctcacccagaaa
gcccaggttggggagctgaaggatgaagatttcgaacccatatgtgagctgggtgcagga
aacggaggggtggtcaacaaagtccgccacaaaccctcgggcttggtcatggctcggaag
ttgatccacctggaaatcaaacctgccatcagaaaccagattatcagagagctgcaggtc
ctgcatgaatgcaactcaccctatattgtgggcttctatggcgccttctacagtgatgga
gagatcagcatctgtatggagcacatggatggcggatccttggaccaggttcttaaagaa
gccagaagaatcccagaagaaatccttggaaaagttagcatagctgtgttgaggggattg
gcatatctgcgagagaagcaccagatcatgcacagagacgtcaagccctccaacatactg
gtcaactctcgtggggagatcaagctgtgcgacttcggtgttagcggccagctcatagat
tccatggccaactcctttgttggaacgcgctcctacatgtcgccggagagactgcagggc
actcattactcggttcagtctgacgtgtggagcatgggtctgtctctggtagagctggcg
attggccgctaccccatccccccaccagacaccagagaactggaggccatctttggacgg
gccgttgtggatggggctgagggagagcctcacgtcaacatgcagaggcctagaccaccc
ggaaggcctataagtggatctgggatggacagcagacctgccatggccatctttgaactt
ttggactacattgtcaatgagccaccccccaaactgccgcttggtgtcttcaccagtgac
ttccaggactttgtgacaaaatgtttgattaaaaacccagccgagagagcggatctgaag
atgctcatgagtcacacattcatcaagcgatcagaagtggaggaagtggactttgccggc
tggttgtgcaaaaccatgggcctcaaccagcccagcactcccacccgcggcgccgagtga

KEGG   Maylandia zebra (zebra mbuna): 101484555
Entry
101484555         CDS       T02814                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04270  Vascular smooth muscle contraction
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04540  Gap junction
mze04620  Toll-like receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101484555
   04012 ErbB signaling pathway
    101484555
   04370 VEGF signaling pathway
    101484555
   04371 Apelin signaling pathway
    101484555
   04068 FoxO signaling pathway
    101484555
   04150 mTOR signaling pathway
    101484555
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101484555
  09143 Cell growth and death
   04210 Apoptosis
    101484555
   04218 Cellular senescence
    101484555
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101484555
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101484555
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101484555
  09152 Endocrine system
   04910 Insulin signaling pathway
    101484555
   04912 GnRH signaling pathway
    101484555
   04916 Melanogenesis
    101484555
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101484555
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101484555
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101484555
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101484555
Protein kinases [BR:mze01001]
 Serine/threonine kinases: STE group
  STE7 family
   101484555
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo NAD_binding_6
Other DBs
NCBI-GeneID: 101484555
NCBI-ProteinID: XP_004542558
UniProt: A0A3P9DJD9
LinkDB
Position
LG18
AA seq 395 aa
MAPKKRPVPLNIAPASDGLSTSMNTEITSEANLEALKKILEELDLDEQQKKRLEAFLTQK
AKVGELKDDDFHRICELGAGNGGVVNKECHKPSGIIMARKLIHLEIKPAIRNQIIRELQV
LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVMKEAKRIPEEILGKVSIAVLRGL
AYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQG
THYSVQSDVWSMGLSLVELSVGRFPIPPPDAKELEAIFGRPILDDTQGQTHSTSPRPKPP
GRPVSGHGPVMAIFELLDYIVNEPPPKLPHGVFTPDFQDFVTKCLIKNPADRADLKMLMN
HTFIKRSEAEEVDFAGWLCKTMGLNQPSTPTRTAD
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggctcctaaaaagagaccagtgcccttaaacattgctcctgctagtgatggattatcc
acctccatgaatacagagattacatctgaggccaatttagaagcgctgaagaaaatactg
gaggagctggacctggatgaacaacaaaagaaaagattagaagctttccttacccagaag
gccaaggttggcgagctgaaagatgatgacttccatcgtatctgtgagctgggtgcaggc
aacggaggagtggtcaacaaggagtgccacaaaccttcaggcataatcatggccagaaaa
ctcatacatttagaaataaaacctgcaataagaaaccagatcatcagagagcttcaggta
ctacacgagtgtaattctccctacattgtgggtttctatggagctttttacagcgatgga
gaaatcagcatctgcatggaacacatggatggtggctctctggaccaggtgatgaaagaa
gcaaagcggattcctgaagagattctgggcaaagtcagcattgctgttttgagaggcctt
gcctacctaagagaaaaacatcaaatcatgcatagagatgtgaaaccctcaaacatcctg
gtaaactcacgcggggagatcaagctgtgtgactttggtgtgagcgggcagctcatagac
tcaatggccaattcctttgttggaacaagatcctacatgtcgcctgagagattgcagggg
actcattactctgtgcagtctgatgtgtggagtatgggcttgtcccttgtagagctgtca
gttggacgctttcccatcccccctccagatgctaaggagctggaggccatatttggacga
ccgatcttggatgatacacagggacagacccacagcacatcccctagacccaaacctccg
ggtagacctgttagtggccacggtccggtaatggctatctttgaactactagactacatt
gtcaatgagccaccgcctaaactaccccatggagtattcacccctgattttcaggatttt
gtgaccaagtgtctcatcaaaaatccagcagacagggctgacttaaaaatgttaatgaac
cacacgtttatcaagcggtctgaagcagaggaggtggatttcgctgggtggctttgtaaa
acaatgggactgaaccaacccagcactcccacacgcactgcagattga

DBGET integrated database retrieval system