KEGG   Maylandia zebra (zebra mbuna): 101465508
Entry
101465508         CDS       T02814                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101465508 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101465508 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mze04052]
    101465508 (kitlg)
Cytokines and growth factors [BR:mze04052]
 Growth factors
  Growth factors (RTK binding)
   101465508 (kitlg)
SSDB
Motif
Pfam: SCF CENP-F_leu_zip
Other DBs
NCBI-GeneID: 101465508
NCBI-ProteinID: XP_004564497
UniProt: A0A3P9C5T9
LinkDB
Position
LG7
AA seq 265 aa
MKKSKSWIHVCVHFLLFITLGVHSDRLNVNPVTNDIAKLSTLRQNIPKDYLIPLEYIPKE
EAGMCWMKLNIFYLEESLVRLSEKFGNVSSNKENISIFIQILQEQRVHMQDLNDIMLDFE
CHYREERFDTNQYFDFIEDLLRAAQNKEDAHDCDVPPCPTSPYPPLIDEYSEESPTTSPP
CPNDCNTSEQQRLLPEVVERSLLSLLFIPLLAIVFLLVWKVRSRRNQDDVQQNPAEEGLT
GTEGTAPPLDTEISEKNMLNVIEIV
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaagttggatacacgtctgtgtccatttcctgctgttcattacgctt
ggggtgcattcagatagacttaacgtcaacccagtgaccaatgacatcgctaaactctcc
actttgagacaaaatattcctaaagattacctaattcctctagagtacattcctaaagaa
gaggctgggatgtgttggatgaaattaaatatcttctatttggaggaaagcttagtaagg
ttatcagaaaagtttggaaacgtttcatccaataaagagaacattagcatattcattcag
attctccaagaacaaagggtccatatgcaggatctgaatgacatcatgcttgattttgag
tgccactatagggaagagaggtttgacaccaaccaatactttgacttcatcgaagattta
ctcagagctgcacagaataaagaagatgcacacgactgtgatgttcctccctgtcccacc
tcaccatacccaccattaatagacgagtattcagaagagtcccccactaccagcccaccg
tgtccaaatgactgcaacacaagtgagcaacaaagactcctgcctgaggtggtggagaga
agccttctctccttactcttcattccacttttagccatcgtgttcttgcttgtatggaag
gtcagatcacggaggaaccaggacgatgttcaacagaatcctgcagaagaaggactcaca
ggaacagaagggactgcacctccactagatactgaaatatcagaaaagaacatgctgaac
gtcattgaaatagtgtaa

DBGET integrated database retrieval system