KEGG   Maylandia zebra (zebra mbuna): 101465626Help
Entry
101465626         CDS       T02814                                 

Gene name
gck
Definition
(RefSeq) glucokinase isoform X1
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00010  Glycolysis / Gluconeogenesis
mze00052  Galactose metabolism
mze00500  Starch and sucrose metabolism
mze00520  Amino sugar and nucleotide sugar metabolism
mze00524  Neomycin, kanamycin and gentamicin biosynthesis
mze01100  Metabolic pathways
mze01200  Carbon metabolism
mze04910  Insulin signaling pathway
Module
mze_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mze_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101465626 (gck)
   00052 Galactose metabolism
    101465626 (gck)
   00500 Starch and sucrose metabolism
    101465626 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    101465626 (gck)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101465626 (gck)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101465626 (gck)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     101465626 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 101465626
NCBI-ProteinID: XP_004547048
LinkDB All DBs
Position
LG12
AA seq 478 aa AA seqDB search
MPCVSVQLDQMVKLPSSYDSVVDKVIAVDQILSEFRLNKEDLKEIMKRMQREMERGLRLE
THEEASVKMLPTYVCSTPEGSEVGDFLALDLGGTNFRVMLVKVGEDEERSFKVETKNQMY
SIPEDAMTGTAEMLFDYIAECMSDFLDKHHIKHKKLPLGFTFSFPVRHEDIDKGILLNWT
KGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGT
GCNACYMEEMRTVELVEGEEGRMCVNTEWGAFGDNGELEDFRLEYDRVVDEASINPGQQL
YEKLISGKYMGELVRLVMMKLVNEDLLFNGEASELLKTRGSFETRYVSQVESDTGDRKQI
YNILSSLGVLPSELDCDIVRLVCESVSTRSAHMCATGLAGVINLMRERRSEEAMKITVGI
DGSVYKLHPCFRDRFHKVVRDLTPHSDITFIQSEEGSGRGAALISAVACKMATNLFAD
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtgtcagcgttcaactcgaccagatggtgaagttgcctagtagctacgactct
gtggttgataaagtcatcgcggtggaccagatcctgtccgagttcaggctgaataaagaa
gacctgaaagagatcatgaagaggatgcagcgtgaaatggagagaggattgcgtttggag
acacatgaagaggctagcgttaaaatgcttccaacttatgtctgctccacccctgaagga
tcagaggttggtgatttcttggctctggacctgggaggcacaaacttccgtgtgatgctt
gtgaaagtgggtgaagacgaagagaggagcttcaaggttgaaacaaagaaccaaatgtac
tccattcctgaagatgccatgactgggactgctgaaatgctattcgactacatagcagag
tgtatgtcagatttcttggacaaacaccacatcaagcacaagaagcttcctctgggtttc
acgttctcctttccagtacgacatgaggacattgacaagggaatcctgcttaactggacc
aaaggcttcaaggcctccggtgcagaagggaacaatgttgtgggtttactcagagacgcc
atcaagagacgaggggactttgagatggatgtggttgccatggtgaatgacacagttgcc
acgatgatttcctgctattatgaagatcgcagctgtgaagtcgggatgattgttggtact
ggttgcaatgcatgttacatggaggaaatgaggactgtggagctggttgaaggggaggag
ggccggatgtgtgtgaacacagaatggggggctttcggagacaacggggagctagaggac
tttagactggagtacgacagagtggtggacgaagcctcaattaaccccggacagcagcta
tatgagaagcttatcagtgggaagtacatgggtgaactggtgaggcttgttatgatgaag
ctagtaaatgaagacctgctgtttaatggtgaagcctcagagctgctgaagacacgtgga
agctttgagacacgctatgtctcacaggtggagagtgacactggggatagaaaacaaatc
tacaacatcctgtcctcgctgggagttctgccctcagagcttgactgtgacattgtccgt
ctggtctgcgagagtgtttccactcgctctgctcacatgtgcgccacagggctcgctggt
gtcatcaacctgatgcgggagagacgcagcgaggaagccatgaagatcacagtgggcatc
gatggatctgtctacaagttgcacccatgtttccgtgacaggttccacaaagtcgtcagg
gacctaacacctcactctgatatcaccttcatccagtcagaggaggggagcggtcgtgga
gctgctcttatctcagcagtggcctgtaaaatggctacaaatctgttcgcggattaa

DBGET integrated database retrieval system