KEGG   Maylandia zebra (zebra mbuna): 101465777
Entry
101465777         CDS       T02814                                 

Definition
(RefSeq) TGF-beta receptor type-2 isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04060  Cytokine-cytokine receptor interaction
mze04068  FoxO signaling pathway
mze04144  Endocytosis
mze04218  Cellular senescence
mze04350  TGF-beta signaling pathway
mze04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101465777
   04350 TGF-beta signaling pathway
    101465777
   04068 FoxO signaling pathway
    101465777
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101465777
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101465777
  09143 Cell growth and death
   04218 Cellular senescence
    101465777
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101465777
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101465777
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101465777
Protein kinases [BR:mze01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101465777
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal FlaC_arch
Other DBs
NCBI-GeneID: 101465777
NCBI-ProteinID: XP_004560129
UniProt: A0A3P9DI28
LinkDB
Position
LG11
AA seq 596 aa
MKARRCSLTFRGVVSAFLISVLLEPGAAGLVFQLHELCKFCDVELTSCNGTGICKTNCSI
SSICEKPTEVCVSIWRRNETNLSIETLCHNPAEPLYGITLDDYNSTTCVMKEKNTTTGLA
HFCSCKGAECNEELIFSQSDRIIEDGEAVDPTPDPLESNHSLISAVLVSMLPLLVMVIAF
FGMFYWCRIHRQRRPNRQWESSFNFKRKPIAGGLDCSDACAIMTDDDKSDSSSTHANSLN
HNTEPLPIELDLLVGKGRFAQVYKAKLKQTTWNQFETVAVKIFPYEEYASWKNEKDIFSN
TDLRHENILHFLTAEERKVEKQYWLITAFHPKGNLQEYLTHHVISWQELQVFSSSLARGV
AHLHSDRLPCGSPKVPIVHRDLKSSNILVKNDGTCCVCDFGLGLCLDSSLSVDELANSGQ
VGTARYMAPEVLEARLNLENIESFKQTDIYSMALVLWEMTSRCEAIGEVKDYEPAYGSKV
REHPCVESMKDNVLRDRGRPEIPDSWLRHQGMAVMCATIKECWDHDPEARLTAHCIAERI
SELEDEMGKLSSRSSSAEKIVEELKIPVEVEIPEEEVKITEIQNIIAVDCSISDKK
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgaaggcacggcgctgctctctaactttccgcggagttgtatcagcctttctcatatct
gtgctgctggagcccggggctgccggtcttgtttttcaactacatgaactttgtaagttc
tgtgatgtggagcttacctcctgcaatggcacaggtatctgcaagaccaactgcagcatc
tcatccatatgtgaaaaaccaactgaggtctgtgtttctatctggagaagaaacgagaca
aacttgtccatcgaaactctctgccacaacccagcagagccattgtacggcattaccctg
gatgactacaacagcaccacctgtgtgatgaaggaaaagaacacaacaacggggttggct
catttctgctcctgtaaaggagcagagtgcaacgaagagctaatattctcccaaagtgat
aggatcattgaggatggagaggctgtggatccaactccagatccactggagtccaaccac
tctttgatatctgcagttctggtgagcatgctgcccctgctggtgatggtgatcgcgttt
tttggaatgttctactggtgcagaatccatcggcagaggcgtcccaaccgccaatgggag
agcagctttaactttaagcgtaagccaatagccggtgggctggactgcagtgacgcctgc
gccatcatgacagatgacgataagtccgacagcagctcgactcatgccaacagtctgaac
cacaacacagagccgctgcctatagagctggatctgctggtgggaaagggtcgctttgct
caggtatacaaggctaaattgaagcagactacgtggaatcagtttgaaacagtagctgta
aagatcttcccctacgaagagtacgcctcctggaagaacgagaaggacattttctccaac
acagacctccgacatgagaatatcctccacttcctgacagctgaggagcggaaggtggag
aaacagtactggctgatcacggccttccaccccaaaggaaacctacaggagtacctgaca
catcacgtgatcagctggcaggagctgcaggtgttcagcagctctctggcacggggtgtt
gcccacctccacagtgatcgcctcccctgtggaagccctaaggtgccgatagtccaccga
gacctgaagagctccaacatcctggtgaaaaacgacgggacgtgctgtgtttgtgacttt
ggcctgggactctgtctggacagcagcctgtcagtggatgaacttgccaacagtggacag
gtgggcactgcgcgctatatggcaccagaggtgctggaggcccgactaaatctggagaac
atcgagtctttcaagcagactgacatttactccatggctctggtcctgtgggagatgacg
tcaaggtgtgaagctattggagaagtaaaggattacgagccggcgtacggctctaaagtg
cgagagcacccctgtgtggagagcatgaaggataatgtgctgagagacagagggaggcct
gagatccccgacagctggctcaggcaccagggcatggcagtgatgtgcgccaccattaag
gaatgctgggaccacgatcccgaggcccgcctcactgcacactgcattgccgaacgcatc
tctgagctggaagacgagatgggcaagctgtccagccggagctcctcggcggagaagatt
gtagaggaactaaagatcccagtagaggtggagatcccagaggaggaagtgaaaattaca
gaaatacaaaacatcatagctgtggactgctccattagcgacaagaagtga

DBGET integrated database retrieval system