KEGG   Maylandia zebra (zebra mbuna): 101465875
Entry
101465875         CDS       T02814                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04350  TGF-beta signaling pathway
mze04371  Apelin signaling pathway
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101465875
   04350 TGF-beta signaling pathway
    101465875
   04371 Apelin signaling pathway
    101465875
   04150 mTOR signaling pathway
    101465875
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101465875
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101465875
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101465875
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101465875
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH Seadorna_VP7
Other DBs
NCBI-GeneID: 101465875
NCBI-ProteinID: XP_004561705
UniProt: A0A3P9DB12
LinkDB
Position
LG10
AA seq 509 aa
MAAVFDIDLDQPDENVSDEEFEDGGQLSEYMEQCSSFDFNMDDCEKFEISENSVNKGTEQ
IRPECFELLKVLGKGGYGKVFQVRKVSGATSGKIFAMKVLKKAMIVRNAKDTAHTKAERN
ILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMA
LGHLHQKGIIYRDLKPENIMLNNNGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEIL
MRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLSLPPYLTQEARDLLK
KLLKRNASLRLGGGPGDAAEVQAHTFFRLINWDELLARKVEPPFKPFLQSADDVSQFDSK
FTSQTPVDSPDDSMLSESANQVFLGFTYVAPSVLENVKEKFSFEPKVRSPRKFPGSPRTP
VSPVKFAGGGNWHRGPLMTGSPSLLSPSSSMDQPMEVSAVEQMDTSGSGFTEASAPLPIR
HPSGISVGPYKKQAYPMNSKRPEHLRMNL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggccgcggtttttgacatcgatttggatcaaccggatgagaatgtctctgacgaagaa
tttgaggatggggggcagctcagtgagtacatggagcagtgcagtagctttgattttaac
atggatgactgtgagaagtttgaaatttcagagaacagcgtgaacaaaggaacagagcag
atcaggcccgaatgctttgagctgctgaaagttttgggaaaaggtggctatgggaaggtg
ttccaggttcggaaggtatcgggtgccacctctgggaagatatttgctatgaaggtttta
aagaaggccatgattgtgcgtaacgcaaaggacaccgcccacaccaaagccgagaggaac
atattggaggaggttaaacatccgttcattgttgacctgatctatgccttccagacgggg
ggaaagttgtacctcatccttgagtatctgagcggcggggagctgttcatgcagctggaa
agagagggaatcttcatggaggacacagcatgtttctacctggccgagatctcaatggcg
ctgggtcacctgcaccaaaaaggcatcatctacagggacttaaaacctgagaacatcatg
ctcaataacaacggacacgtgaagctgacggatttcggcctatgcaaagagtccatccat
gatggaacagtcacccacaccttctgcggcactatcgagtacatggctccagagatcctg
atgaggagtggacataatcgtgctgtggactggtggagtctgggagcgctcatgtacgac
atgctgacaggagcacctccgttcaccggtgaaaaccgaaagaagaccatagacaaaatc
ttaaaatgtaaactcagccttccaccttacctcacgcaagaagccagggaccttctgaaa
aagttgctgaagagaaatgcctcgttgcgactcgggggcggtccaggagatgcagctgaa
gtccaggcccatacgttcttccgccttataaattgggacgaactccttgctcgcaaagta
gagcctccatttaaaccatttctgcaatcagctgatgatgtcagccagtttgattccaag
ttcaccagtcagactccagtggacagccccgatgactccatgctcagtgaaagtgccaat
caagtcttcctgggtttcacatatgtagccccatctgtgcttgaaaacgtcaaagagaag
ttctcctttgagccaaaggtccgctcgccgcgaaagttcccgggaagcccgagaacacct
gtgagtccggtgaagtttgcaggggggggcaactggcaccggggacctttgatgactggc
agcccatctctgctttcacccagcagctcgatggaccagcccatggaggtttcagcagtg
gagcaaatggacacgagcggcagcggcttcaccgaggcttctgcgccgcttcccatcagg
cacccttcaggcatcagtgtagggccctacaagaagcaggcgtaccccatgaactccaag
cggcccgaacacctacgaatgaacctatga

KEGG   Maylandia zebra (zebra mbuna): 101478146
Entry
101478146         CDS       T02814                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04350  TGF-beta signaling pathway
mze04371  Apelin signaling pathway
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101478146
   04350 TGF-beta signaling pathway
    101478146
   04371 Apelin signaling pathway
    101478146
   04150 mTOR signaling pathway
    101478146
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101478146
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101478146
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101478146
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101478146
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 101478146
NCBI-ProteinID: XP_004538758
LinkDB
Position
LG6
AA seq 484 aa
MRGTQTALCGCLSRMAGVFDIDLETEDISDTEDDVCDFTVPEPENAQTEEVELTSESVNR
DRERVGPDCFELLTVLGKGAYGKVFQVRKVQGAQTGRIFAMKVLKKAKIVCNAKDTAHTR
AEREILETVRHPFIVDLLYAFQTGGKLYLILECLSGGELFMQLEKEGIFMEDTACFYLGE
ITLALGHLHSNGIIYRDLKPENIMLNHQGHIKLTDFGLCKESIHDGSVTHTFCGTIEYMA
PEILTRSGHNRAVDWWSLGALMYDMMTGSPPFTAENRKKTIDKILKCKLSLPPYLTIDAR
DLVKKLLKKNPAQRLGSSKADCADIQKHAFFKHVNWDELLHKRVEPPYKPQLQSDEDVSQ
FDTRFTRQTPVDSPDDTSLSHSAELAFAGFTYVAPSVLESLKEGFSFEPRARNVRRHNSS
PRTPISPLKFSPAGPFKSSLDGEPDPFSPMSPPTAAAPMPKENGAASQPIKTPARNKKLK
GHRR
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgagaggaacccaaacagctctctgtggttgtttgtccaggatggcaggagtgttcgac
atcgacttggagactgaggacatcagtgacacagaggatgatgtgtgtgacttcactgtc
ccagaaccagaaaatgcccagacggaggaggtggagctgaccagtgaaagtgtcaacagg
gaccgtgagagagtcggaccggactgctttgagcttcttactgtgctgggaaaaggagct
tatggcaaagttttccaagtgaggaaggttcaaggggctcagacagggagaatttttgcc
atgaaggtcctgaaaaaggcaaagatagtgtgcaacgctaaagacacggcccatacgcga
gcagagcgagagatcctggagacggtgaggcacccgttcatcgtagatctgctgtacgcc
ttccagactggaggaaaactctacctcatcctggagtgtctgagcggaggagagttgttc
atgcagctggagaaggaaggcatcttcatggaggacactgcctgcttctatctcggagag
atcactctggccctcggtcacctccactctaacgggattatttatcgggacctgaaacct
gaaaacatcatgctcaatcaccaaggacacatcaagctgactgactttgggctctgcaaa
gaatcgattcacgatggatccgtcacacacaccttctgcggcaccatcgagtacatggct
ccagagatcctgaccaggtcgggtcacaacagagcggtggactggtggagcctcggggcg
ctcatgtacgatatgatgactggatcgcctccgttcacggcggaaaacaggaagaagacc
atcgataagatcttgaagtgtaaactcagcctgccgccgtacctgacaatcgatgccaga
gacctcgtcaaaaagctgttgaagaaaaacccagcccaaagacttggctccagtaaagca
gactgtgctgacatccagaaacacgccttctttaaacacgttaactgggacgagctgctg
cataagagagtggagccgccgtataagccacagctgcagtcggatgaggacgtgagccag
tttgacaccaggtttaccagacagacgcccgtggacagtccggatgatacttcgctcagc
cacagcgcagagctcgccttcgctggtttcacatacgtggctccatcggtcctcgagagt
ctaaaggaaggcttctcattcgaaccccgagcgagaaacgtacgccgacacaacagcagc
ccacgcacgcccatcagtcctttaaaattttcccccgctgggccgttcaagtccagcctc
gacggagagccagaccctttctctccgatgtctccaccgacagcggcagctccgatgccg
aaggaaaacggagccgccagtcagccaatcaaaacccctgcgaggaacaagaagctgaaa
ggacatcggagatga

KEGG   Maylandia zebra (zebra mbuna): 101485102
Entry
101485102         CDS       T02814                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04350  TGF-beta signaling pathway
mze04371  Apelin signaling pathway
mze04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101485102
   04350 TGF-beta signaling pathway
    101485102
   04371 Apelin signaling pathway
    101485102
   04150 mTOR signaling pathway
    101485102
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101485102
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101485102
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101485102
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101485102
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101485102
NCBI-ProteinID: XP_004561406
LinkDB
Position
LG14
AA seq 503 aa
MAGVFDIDLDQPEENVSDDENEEGQIADLMEQCIEFNMDDCEKIEISEDNVNQGTENIRP
ECFELLRVLGKGGYGKVFQVRKVVGAAAGKIFAMKVLKKAMIVRNAKDTAHTKAERNILE
EVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGH
LHQKGIIYRDLKPENIMLNSQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRS
GHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLSLPPYLTHEARDLLKKLL
KRNASSRLGAGAGDAAEVQGHTFFRHINWEELLARKVEPPFKPFLQSADDVSQFDSKFTS
QTPVDSPDDSTLSESANQAFLGFTYIAPSVLENIKEKFSYEPKIRSPRRITDSPRTPLSP
VKFSGGHCWHRSPLVPSGGPGVLQSPQDQAMELSTPEQMDITTSAEASAPLPIRQPAGIN
LAQMKQQAYPVMAKRPEHLRMNL
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggctggagtgtttgacattgatttggaccagccggaggaaaatgtctccgacgatgag
aacgaggagggtcaaatcgctgatctcatggagcagtgcattgagttcaacatggatgac
tgcgagaagatcgagatatccgaggacaacgtcaatcagggcacagagaacatccgaccg
gagtgcttcgagctgctgcgcgtcctggggaagggtggctacggaaaggtttttcaagtt
cgaaaggttgttggcgctgcagcgggcaaaatatttgccatgaaagttttaaaaaaggct
atgattgtgcgcaacgccaaggacacagcccacaccaaggcggagaggaacatcctggag
gaagtaaagcatcccttcattgtcgatctcatctacgcctttcagacgggagggaagcta
tacctcatcctggagtatctgagtggaggagaactctttatgcagctggagagagagggc
atcttcatggaagacacagcctgtttttacctggcagagatctccatggctctgggtcac
ctgcaccagaagggcatcatctacagagacctaaagcccgagaacatcatgcttaacagc
caaggtcacgtaaagctgacagacttcgggctgtgtaaagaatccattcacgacggcacg
gtcacgcacactttctgtggcaccattgaatatatggctccagagatcctcatgagaagc
gggcacaacagagcggtggactggtggagtctgggcgctctgatgtacgacatgctcaca
ggagcgccgcctttcactggtgaaaaccgaaaaaagacaattgacaagatcctgaagtgt
aagctcagcctcccgccgtacctcacacatgaagctcgagacctcctaaaaaagttgcta
aagagaaacgcttcatcgcgcctgggagcgggagcaggagacgctgcagaggtgcagggt
cataccttcttccgacacatcaactgggaggagttgctggctcggaaagtggagcctccc
ttcaagccttttctgcaatcggctgacgacgtgagtcagtttgactcaaagttcaccagt
cagacgcccgtcgatagcccggatgactcgaccctcagtgagagcgccaatcaagccttc
ctgggtttcacgtatatcgctccatcggtcctggaaaacatcaaagaaaaattctcgtat
gagccaaaaatccgctcaccccgacgcatcacggacagcccaaggacaccgctcagcccg
gtcaagttttcaggggggcactgttggcatcggagccccctcgttcccagcggtggaccc
ggtgtcctccagtctcctcaagaccaggccatggaactgtccaccccagagcagatggac
atcacaaccagcgccgaggcctcggcccctctccccatccgtcagcctgctgggatcaac
cttgctcagatgaagcagcaagcctatcctgtcatggccaaacggcccgagcatctacgt
atgaacctatga

DBGET integrated database retrieval system