KEGG   Maylandia zebra (zebra mbuna): 101465888
Entry
101465888         CDS       T02814                                 

Gene name
kras
Definition
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04137  Mitophagy - animal
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04540  Gap junction
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101465888 (kras)
   04012 ErbB signaling pathway
    101465888 (kras)
   04370 VEGF signaling pathway
    101465888 (kras)
   04371 Apelin signaling pathway
    101465888 (kras)
   04068 FoxO signaling pathway
    101465888 (kras)
   04150 mTOR signaling pathway
    101465888 (kras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101465888 (kras)
   04137 Mitophagy - animal
    101465888 (kras)
  09143 Cell growth and death
   04210 Apoptosis
    101465888 (kras)
   04218 Cellular senescence
    101465888 (kras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101465888 (kras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101465888 (kras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101465888 (kras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101465888 (kras)
   04912 GnRH signaling pathway
    101465888 (kras)
   04914 Progesterone-mediated oocyte maturation
    101465888 (kras)
   04916 Melanogenesis
    101465888 (kras)
Membrane trafficking [BR:mze04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101465888 (kras)
GTP-binding proteins [BR:mze04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101465888 (kras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha ATP_bind_1 FeoB_N Gtr1_RagA Septin CbiA AAA_25
Other DBs
NCBI-GeneID: 101465888
NCBI-ProteinID: XP_004563508
UniProt: A0A3P9CNM6
LinkDB
Position
LG7
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRLYRVNKISKEEKTPRC
VKLKKCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacagaatataaactggttgtggtgggagctggtggcgttggcaaaagcgcacttacc
attcagctcatccagaatcacttcgtggatgagtatgaccccaccattgaggactcttac
agaaagcaggtagtcattgacggagagacatgtctactggacatcctggacacagcaggt
caggaggagtacagcgccatgagggatcaatacatgaggacaggggagggtttcctctgt
gtctttgccatcaacaataccaagtcctttgaagacattcaccactatagagaacagatt
aagcgggtgaaggactctgaggacgtccccatggtgctggtggggaacaagtgtgacctc
ccgtcccggacagtggacacaaagcaggctcaggacttagcacgtagctacggcattccc
tttattgagacctcagccaaaaccagacagagagtggaagatgccttttacactctggta
cgggagatcaggctgtaccgggtcaataagatcagcaaggaagaaaagactccgcgctgt
gtcaagcttaaaaagtgtgttgtgatgtga

KEGG   Maylandia zebra (zebra mbuna): 101474892
Entry
101474892         CDS       T02814                                 

Gene name
hras
Definition
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04137  Mitophagy - animal
mze04140  Autophagy - animal
mze04144  Endocytosis
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
mze05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101474892 (hras)
   04012 ErbB signaling pathway
    101474892 (hras)
   04370 VEGF signaling pathway
    101474892 (hras)
   04371 Apelin signaling pathway
    101474892 (hras)
   04068 FoxO signaling pathway
    101474892 (hras)
   04150 mTOR signaling pathway
    101474892 (hras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101474892 (hras)
   04140 Autophagy - animal
    101474892 (hras)
   04137 Mitophagy - animal
    101474892 (hras)
  09143 Cell growth and death
   04210 Apoptosis
    101474892 (hras)
   04218 Cellular senescence
    101474892 (hras)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101474892 (hras)
   04540 Gap junction
    101474892 (hras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101474892 (hras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101474892 (hras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101474892 (hras)
   04912 GnRH signaling pathway
    101474892 (hras)
   04916 Melanogenesis
    101474892 (hras)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101474892 (hras)
Membrane trafficking [BR:mze04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101474892 (hras)
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101474892 (hras)
  Exosomal proteins of colorectal cancer cells
   101474892 (hras)
GTP-binding proteins [BR:mze04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101474892 (hras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA Septin ATP_bind_1 AAA_25
Other DBs
NCBI-GeneID: 101474892
NCBI-ProteinID: XP_004563448
UniProt: A0A3P9CMD3
LinkDB
Position
LG7
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PARTVDTRQAHELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagctggtggtggtgggagctggaggcgtgggcaagagtgcacttacc
atacagctgatccagaaccactttgtggatgaatatgaccccacaatagaggactcatac
aggaagcaggttgtgatcgacggggagacctgcctgttggacatcctggacactgcaggt
caagaggagtacagcgccatgagggatcagtacatgaggacgggggagggcttcctgtgt
gtcttcgccatcaacaataccaagtcttttgaggacattcaccagtatagagaacagatt
aagcgtgttaaggattccgatgatgttcccatggtccttgtgggaaacaaatgtgacctc
cctgcgcgcacggtggacacgaggcaagcccatgagctcgctcgctcctatggcatcccc
tacattgagacctctgccaaaacacggcagggagtagaggacgccttctacacactggtt
agagagatcaggcagcataagttgaggaagttgaacccacccgatgagagtggtcaagac
tgtatgagctgtcgctgtgtggtgtcgtga

KEGG   Maylandia zebra (zebra mbuna): 101485266
Entry
101485266         CDS       T02814                                 

Definition
(RefSeq) GTPase HRas
  KO
K07827  GTPase KRas
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04137  Mitophagy - animal
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04540  Gap junction
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101485266
   04012 ErbB signaling pathway
    101485266
   04370 VEGF signaling pathway
    101485266
   04371 Apelin signaling pathway
    101485266
   04068 FoxO signaling pathway
    101485266
   04150 mTOR signaling pathway
    101485266
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101485266
   04137 Mitophagy - animal
    101485266
  09143 Cell growth and death
   04210 Apoptosis
    101485266
   04218 Cellular senescence
    101485266
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101485266
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101485266
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101485266
  09152 Endocrine system
   04910 Insulin signaling pathway
    101485266
   04912 GnRH signaling pathway
    101485266
   04914 Progesterone-mediated oocyte maturation
    101485266
   04916 Melanogenesis
    101485266
Membrane trafficking [BR:mze04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101485266
GTP-binding proteins [BR:mze04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101485266
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 FeoB_N ATP_bind_1 POC3_POC4 Septin SatRNA_48
Other DBs
NCBI-GeneID: 101485266
NCBI-ProteinID: XP_004573764
UniProt: A0A3P9BXI7
LinkDB
Position
LG4
AA seq 187 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFEDVHLYREQISRVKDSDSVPMVLVGNKSDL
STRTVKTQQAQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKNT
QRRCMIL
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaccgagtacaaacttgtggtggtcggggcaggaggtgtgggcaagagcgctctcacc
atccagctcatccagaaccactttgtggatgaatacgatccaactatcgaggactcgtac
agaaagcaggtggtgattgatggagagacatgtctgctggacatcctggacactgcaggt
caggaggagtacagcgccatgagggaccagtatatgaggacgggagaaggcttcctctgt
gtgtttgccatcaacaacagcaagtcctttgaggacgttcacctttacagagagcagatc
agtagggtgaaggacagtgacagcgtccccatggtgctcgtggggaacaagagcgacctc
agcacccgcacagtgaagacgcagcaggcgcaggagctggcgaggagctacggcgtgccg
tttgtagagacctccgccaaaaccagacagggtgtggaggaagctttttattctctagta
cgggagatcagaagatacaaggagaccaaccgcagcaacaagaagagcaagaagaacact
cagagacgttgcatgatactatag

DBGET integrated database retrieval system