KEGG   Maylandia zebra (zebra mbuna): 101466452
Entry
101466452         CDS       T02814                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04261  Adrenergic signaling in cardiomyocytes
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04920  Adipocytokine signaling pathway
mze05132  Salmonella infection
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101466452
   04012 ErbB signaling pathway
    101466452
   04370 VEGF signaling pathway
    101466452
   04371 Apelin signaling pathway
    101466452
   04068 FoxO signaling pathway
    101466452
   04150 mTOR signaling pathway
    101466452
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101466452
  09143 Cell growth and death
   04210 Apoptosis
    101466452
   04218 Cellular senescence
    101466452
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101466452
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101466452
   04625 C-type lectin receptor signaling pathway
    101466452
  09152 Endocrine system
   04910 Insulin signaling pathway
    101466452
   04920 Adipocytokine signaling pathway
    101466452
   04914 Progesterone-mediated oocyte maturation
    101466452
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101466452
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101466452
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101466452
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101466452
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101466452
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 FTA2
Other DBs
NCBI-GeneID: 101466452
NCBI-ProteinID: XP_024659681
LinkDB
Position
LG10
AA seq 487 aa
MIANSLTMNEVSIVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPDLNDQPSPPLN
NFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVESNEEREGWIRAIQYVANSLKMQ
EQGEEEPMDVLSSPNESSLVEMEAVISKSCTKVTMSDFEYLKLLGKGTFGKVILVKEKTT
GVHYAMKILRKMVIIAKDEVAHTVTESRVLQNTKHPFLTTLKYAFQTHDRLCFVMEYANG
GELFFHLSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDKDGHIKITDF
GLCKEGITPDATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQD
HERLFELILMEEIRFPRNLSPEAKSLLAGLLKKDPKHRLGGGPSDAKEVMTHKFFITINW
HDVEQRKLTPLFKPQVTSETDTRYFDEEFTAQTITLTPPNKYNSLDCEDPSQEAHFPQFS
YSASIRE
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgatcgctaactcccttaccatgaatgaagtcagtatagtgagagagggatggcttcac
aaaagaggtgaatatatcaaaacatggaggcctaggtattttatcctaaagagcgatggc
tctttcatcggttacaaagagaaaccagatttaaatgaccaaccttccccaccactgaac
aacttctcagtggcagaatgccagttaatgaagactgaaagacccagacctaatacattt
gtcatccgttgtctgcagtggaccactgttattgaacgtacttttcatgtagaaagcaac
gaagagagagaggggtggataagggcaatccagtatgtagcgaacagtctgaaaatgcag
gaacagggggaagaggaaccaatggatgttctcagctcaccaaacgaaagcagcctggtg
gagatggaggcagttatatccaagagctgcaccaaagtgacaatgagtgactttgaatat
ctgaagctgcttggaaagggtacctttgggaaggtgattcttgtcaaagaaaagacaact
ggagtacattatgccatgaaaatactgcgcaaaatggtgataatagccaaggatgaagtg
gcccacacggttacagagagccgagtgttacagaacaccaaacatcctttcctcacgaca
ctgaaatatgccttccaaacccacgatcgactctgttttgtaatggaatatgctaatgga
ggcgagctcttcttccacctctcacgtgaacgagtcttcacagaagaccgggcacgtttc
tatggtgctgagattgtatcagcacttgagtacctccattcacgtgacgttgtttaccgt
gatttgaagctggagaatttgatgctggacaaagacggacacattaaaataactgatttt
ggcctttgtaaagagggcattactccagatgcaacaatgaaaaccttttgtggaacacct
gaatatctggctcctgaggtcctagaagataatgactacggccgcgcagtggactggtgg
ggtctcggtgtagttatgtatgaaatgatgtgtggccgattgcctttctataaccaagac
cacgagcgcttatttgagctcatcctaatggaggagatccgctttcctcggaacctctca
cctgaggccaagtccctgctggctggcctgctcaagaaggatcccaagcacaggttagga
ggaggtcccagtgatgccaaagaagtaatgactcacaaattttttatcaccatcaactgg
catgatgtggaacagagaaagctgacccccctcttcaaaccgcaagtaacatcagagaca
gatacccggtactttgatgaggagttcacagcacaaacaatcacactcactcccccaaac
aagtataacagtctggactgtgaggaccccagccaagaagctcatttcccccaattctcc
tattctgctagcataagagagtga

KEGG   Maylandia zebra (zebra mbuna): 101467814
Entry
101467814         CDS       T02814                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04261  Adrenergic signaling in cardiomyocytes
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04920  Adipocytokine signaling pathway
mze05132  Salmonella infection
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101467814
   04012 ErbB signaling pathway
    101467814
   04370 VEGF signaling pathway
    101467814
   04371 Apelin signaling pathway
    101467814
   04068 FoxO signaling pathway
    101467814
   04150 mTOR signaling pathway
    101467814
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101467814
  09143 Cell growth and death
   04210 Apoptosis
    101467814
   04218 Cellular senescence
    101467814
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101467814
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101467814
   04625 C-type lectin receptor signaling pathway
    101467814
  09152 Endocrine system
   04910 Insulin signaling pathway
    101467814
   04920 Adipocytokine signaling pathway
    101467814
   04914 Progesterone-mediated oocyte maturation
    101467814
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101467814
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101467814
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101467814
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101467814
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101467814
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 101467814
NCBI-ProteinID: XP_004562250
UniProt: A0A3P9BAA9
LinkDB
Position
LG6
AA seq 479 aa
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKDKPQDSDLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVAESLAKQEEEGILCS
PTSQIENVNEEEMDTSISHYKRKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDT
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILM
EEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFGTIDWQDVYDKKLVP
PFQPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDAADNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgaccagaacgtcgtcaaggaaggctgggtccagaaaagaggagagtacatcaag
aattggcgaccacgctactttctgctgaagacagacggctctttcatcggctacaaggac
aaaccacaagactctgacctggcctacccactcaacaacttctctgtagcaaaatgccag
ctgatgaagacggagcggccaaagccaaacacctttatcatccgctgtctgcagtggacg
acagtcatcgaaagaacttttcatgttgacactcctgatgagagggacgagtgggctgag
gccatccagatggtagcagagtcactagccaagcaggaggaggagggcatcttgtgcagc
cccacctcccagattgaaaacgtcaacgaggaggagatggacacctccattagccactac
aaacgaaagacaatgaatgactttgactatttgaagcttctgggcaaaggcacttttggt
aaagtcattctggtgagggagaaggcgagcggcacctactacgccatgaaaatcctcaaa
aaagaagtcatcattgccaaggatgaagttgctcacactctcacagaaagtagggtttta
aaaaatactcggcatccattcctaacttctctgaagtattcattccagacaaaggatcgg
ctgtgctttgtaatggagtatgtcaacggaggagagctatttttccacttgtcaagagag
agagttttttcagaggaccgcacccgtttctatggcgctgagatcgtctctgctttagat
tatttgcattctgccaagatcgtgtaccgtgatctgaagctggagaacctcatgttggac
aaagatggccacatcaagatcactgactttggtctctgcaaagaaggcatcactgacact
gccactatgaaaaccttctgtggaacaccggagtacttggctcctgaggtgctagaggac
aatgactatggacgtgcagtggactggtggggtttgggcgtggtgacatatgagatgatg
tgcggacgcctgcccttctacaaccaggaccacgagaagctgtttgagctcatcctcatg
gaagagataaaattcccacgaaccctgtcagctgacgccaagtcactcctgtcagggctg
ctcattaaggaccccaacaaacggttgggcggtggaccggatgacgctaaggagatcatg
cggcacagtttctttggcacaatcgactggcaggacgtctacgacaaaaagttggtacca
cccttccagcctcaggtcacctctgagacagacacgcgctacttcgatgaagagttcaca
gcacagaccatcaccatcactccaccggaaaaatacgatgaggacgggatggatgcagca
gacaacgagcgaaggcctcatttcccacagttctcctactcggccagtggccgagagtga

KEGG   Maylandia zebra (zebra mbuna): 101469973
Entry
101469973         CDS       T02814                                 

Gene name
akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04261  Adrenergic signaling in cardiomyocytes
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04920  Adipocytokine signaling pathway
mze05132  Salmonella infection
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101469973 (akt1)
   04012 ErbB signaling pathway
    101469973 (akt1)
   04370 VEGF signaling pathway
    101469973 (akt1)
   04371 Apelin signaling pathway
    101469973 (akt1)
   04068 FoxO signaling pathway
    101469973 (akt1)
   04150 mTOR signaling pathway
    101469973 (akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101469973 (akt1)
  09143 Cell growth and death
   04210 Apoptosis
    101469973 (akt1)
   04218 Cellular senescence
    101469973 (akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101469973 (akt1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101469973 (akt1)
   04625 C-type lectin receptor signaling pathway
    101469973 (akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101469973 (akt1)
   04920 Adipocytokine signaling pathway
    101469973 (akt1)
   04914 Progesterone-mediated oocyte maturation
    101469973 (akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101469973 (akt1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101469973 (akt1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101469973 (akt1)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101469973 (akt1)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101469973 (akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Pkinase_fungal Seadorna_VP7 FTA2
Other DBs
NCBI-GeneID: 101469973
NCBI-ProteinID: XP_004540846
UniProt: A0A3P9DPZ7
LinkDB
Position
LG19
AA seq 473 aa
MTNVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQAVAEGLQKQEEEMMDS
SPDPMDMEVYLTKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEQILMEDIR
FPRTLGLEARSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFASIEWQDVYEKKLVPPFKP
QVTSETDTRYFDEEFTAQTITITPPGQDDSMESFDSERRPHFPQFSYSASGTA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaccaatgtggtgatcgtcaaggagggatggctgcacaaaagaggagaatacatcaag
acctggaggccaaggtattttctcctgaagagtgatggtacattcattggctacaaagag
cgaccgcaagatgttgaccagctggaaacccccttaaataacttctctgtagcacagtgc
cagctgatgaagacggaacggcccaagcccaacacattcatcatccgctgcctgcagtgg
accactgtcatcgagcgtaccttccacgtggagacccccgaggagagggaagaatggacc
aaagccatccaggcagtggctgaaggcctacagaaacaagaggaggagatgatggactcc
tccccagaccccatggacatggaggtctacctgaccaaacccagactcaaagtgactatg
cacgactttgaatacctcaaactcctgggaaaaggcacttttggcaaagttattctggta
aaggagaaggccacaggacgctactatgccatgaagatcctaaagaaggaggtgatcgta
gcaaaagatgaagtggcgcacacactcacagagaacagagtcctccagaattcaaagcat
ccgttcttgacaggactgaaatactccttccaaacacatgaccgcctgtgctttgtcatg
gagtatgcaaacggtggtgagcttttcttccatctttcaagagaccgggtgttttcagag
gagcgtgcgcggttctacggcgcagagatagtgtctgctttggactacctgcatgctgaa
agaaacgtggtttatcgggatctcaagctggaaaatcttatgctggacaaagacggacac
ataaagatcacagatttcggcctgtgtaaggaggggatcaaagatggcgccactatgaaa
accttctgtgggactccagagtaccttgcacctgaggtgttggaagacaatgactatggc
cgtgctgtggactggtggggtctgggtgtggtgatgtacgagatgatgtgtggcagactg
cctttctacaaccaagaccacgagaagctatttgagcaaatcctcatggaagacatccgc
ttcccccggaccctcggcctcgaagcacgctccctgctctctggtcttctgaagaaagac
ccaaagcaaaggttaggtggaggacctgatgacgccaaggaaatcatgcagcacaagttc
tttgccagcattgaatggcaagatgtttatgagaagaagctggtcccaccatttaagccc
caagttacatcggagacggacacgagatatttcgatgaggagttcacagcacaaaccatc
acgattacgccaccgggacaagatgacagcatggagtcctttgacagtgaacggagaccc
cactttccccaattctcctactctgccagtgggacggcctaa

KEGG   Maylandia zebra (zebra mbuna): 101476427
Entry
101476427         CDS       T02814                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04261  Adrenergic signaling in cardiomyocytes
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04920  Adipocytokine signaling pathway
mze05132  Salmonella infection
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101476427
   04012 ErbB signaling pathway
    101476427
   04370 VEGF signaling pathway
    101476427
   04371 Apelin signaling pathway
    101476427
   04068 FoxO signaling pathway
    101476427
   04150 mTOR signaling pathway
    101476427
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101476427
  09143 Cell growth and death
   04210 Apoptosis
    101476427
   04218 Cellular senescence
    101476427
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101476427
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101476427
   04625 C-type lectin receptor signaling pathway
    101476427
  09152 Endocrine system
   04910 Insulin signaling pathway
    101476427
   04920 Adipocytokine signaling pathway
    101476427
   04914 Progesterone-mediated oocyte maturation
    101476427
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101476427
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101476427
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101476427
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101476427
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101476427
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 101476427
NCBI-ProteinID: XP_004551478
UniProt: A0A3P9DR33
LinkDB
Position
LG13
AA seq 479 aa
MSDVTIVREGWLQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKSNTFIIRCLQWTTVIERTFHVDSPDERDEWTEAIQMVADKLQRQEEERIQCS
PTSNIDNMVEEEMDISTTHHKRKTMSDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEERTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSADAKSLLSGLLFKDPNKRLGGGPDDAKEIMRHSFFSGIDWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKFDEDGMDCLDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgttagagagggatggctccagaaacggggtgaatacataaag
aactggcgaccgcggtacttcctgctgaagacagacggctctttcatcggctacaaagag
aaacctcaggatgccgacctgccctaccccttaaataacttctcagtagcaaaatgtcag
ctgatgaagacagagaggccgaagtcaaacaccttcatcatacgctgcctccagtggacc
acggtcatcgagaggacgttccatgtggactccccagatgagagagatgagtggacagag
gcaattcagatggtggctgacaagctgcagagacaagaggaggaaaggatccagtgcagc
cccacctccaacatcgacaacatggtggaggaggagatggacatctccactacacaccac
aaaagaaagacaatgagcgacttcgactacctgaagctgctgggaaagggaacctttggt
aaagtgattcttgtccgggaaaaggccagcgggaaatactacgccatgaaaatccttaaa
aaagaagtcattatagccaaggatgaagtggctcacacactcacagagagcagagtacta
aaaaacaccaggcacccctttctaacttctctaaaatactcattccagactaaagaccgc
ctctgtttcgtcatggagtatgtgaatggaggagagctgtttttccatttgtccagagaa
cgggtgttctcagaggagcgcacgcgcttctacggcgcagagattgtttcggctctcgac
tacctgcattcagccaagattgtgtaccgggacctcaagttggaaaacttaatgctggat
aaagatggccatatcaaaatcacagattttgggctctgcaaggagggcatcactgatgct
gctaccatgaagaccttctgtggtacaccagagtaccttgcacctgaggtcctggaggac
aatgactacggtcgagcggtggactggtggggtctgggtgttgtgacgtacgagatgatg
tgcggtcgcctgcctttctacaaccaagaccacgagaagctgtttgagctcatcctcatg
gaggacatcaagttcccccgcactctgtcagctgacgcaaagtccctgctgtctggcctg
ctcttcaaagatccgaacaaacggctcggaggagggccagatgatgctaaagaaataatg
agacacagttttttctctggtattgactggcaggatgtctacgataaaaagctcgttcct
ccgttcaagcctcaggtgacgtcggagacagacaccagatactttgatgaggagttcaca
gctcagaccatcacaatcaccccaccagagaaattcgatgaggatgggatggactgtctg
gacaacgagagacgaccacacttcccgcagttctcgtactctgccagcggtcgggaatga

KEGG   Maylandia zebra (zebra mbuna): 101480630
Entry
101480630         CDS       T02814                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04261  Adrenergic signaling in cardiomyocytes
mze04370  VEGF signaling pathway
mze04371  Apelin signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04920  Adipocytokine signaling pathway
mze05132  Salmonella infection
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101480630
   04012 ErbB signaling pathway
    101480630
   04370 VEGF signaling pathway
    101480630
   04371 Apelin signaling pathway
    101480630
   04068 FoxO signaling pathway
    101480630
   04150 mTOR signaling pathway
    101480630
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101480630
  09143 Cell growth and death
   04210 Apoptosis
    101480630
   04218 Cellular senescence
    101480630
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101480630
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101480630
   04625 C-type lectin receptor signaling pathway
    101480630
  09152 Endocrine system
   04910 Insulin signaling pathway
    101480630
   04920 Adipocytokine signaling pathway
    101480630
   04914 Progesterone-mediated oocyte maturation
    101480630
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101480630
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101480630
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101480630
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101480630
Protein kinases [BR:mze01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101480630
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 101480630
NCBI-ProteinID: XP_004543957
UniProt: A0A3P9C854
LinkDB
Position
LG14
AA seq 482 aa
MNEVSVVREGWLHKRGEYIKTWRPRYFILKSNGSFIGYKEKPEVSSDHNLPPLNNFSVAE
CQLMKTERPKPNTFVIRCLQWTSVIERTFHVDSNEEREEWMRSIQAVANSLKSQQQDEEP
MEIKFGSPSDSSGMEDMEIAVSKSHTKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFF
HLSRDRVFTEDRARFYGAEIVSALEYLHSRNVVYRDLKLENLMLDKDGHIKITDFGLCKE
GITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEEIRFPKNLAPEAKALLAGLLKKDPKQRLGGGPDDAKEVMSHKFFTSINWQDVID
KKLIPPFKPHVTSETDTRYFDDEFTAQSITITPPDKYDSLDVEDSDQRTHFPQFSYSASI
RE
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgaatgaagtcagtgttgtgagagagggatggctccacaagagaggtgaatatattaaa
acatggcgtcctcgttacttcatcttaaagagcaatggctccttcattggctacaaagag
aagcctgaggtgtccagtgaccacaacctcccaccactcaacaacttctctgtcgcagag
tgccagctgatgaagacggagcgccccaagcccaacacgtttgtcattcggtgtctgcag
tggacctccgttattgagcggactttccatgtagacagcaatgaggagagggaggaatgg
atgcgatcgatccaggcggtagcaaacagcctgaagagtcagcagcaggatgaggagccc
atggagatcaaatttggctccccgagtgacagcagtggcatggaggacatggagattgct
gtgtccaaatcccacacaaaagtgactatgagtgactttgactacctgaagcttctgggc
aaagggacatttggtaaagtgatcctggtgaaggagaaggccacagggatgtactatgcc
atgaaaatcctgcgcaaagaagttatcattgctaaagatgaggtggcacacacagttaca
gaaagccgagttctccaaaacacacggcatccttttctaacgacactaaaatatgcattt
caaacacacgaccggctatgctttgtgatggagtatgcaaatggaggagaactcttcttt
cacttatcccgggacagagtattcacagaagacagggctcgattctacggtgcagaaata
gtgtcagcactggagtatcttcattcacgcaatgtagtttacagggacctgaagctggag
aacctcatgttagacaaggatggccacataaagataacagacttcggcttgtgtaaagaa
gggatcacagacggcgccaccatgaaaaccttctgtggaaccccggagtacttggcacca
gaggtgctggaggacaacgattatggtcgagcagtggactggtggggattgggtgtagtg
atgtatgagatgatgtgtggccgattgcctttttacaaccaggaccatgagcgcctcttt
gagcttatcctaatggaggagatccgcttccccaagaacctggctcctgaggccaaggcc
ctgctggcaggcctgcttaaaaaagatcccaaacagaggctcggaggtggtccagacgat
gccaaagaagtgatgagccacaagttcttcacctccattaactggcaggatgtcattgac
aaaaagcttattccacccttcaagccacacgtaacatccgagacggacacgcgctacttt
gacgacgagttcacagcacaatctattacaataactcctccagacaagtatgacagttta
gacgtagaggattcagatcagcgtactcacttccctcagttctcctactctgccagcata
cgggaatga

DBGET integrated database retrieval system