KEGG   Maylandia zebra (zebra mbuna): 101466566
Entry
101466566         CDS       T02814                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta 2 chain isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04114  Oocyte meiosis
mze04217  Necroptosis
mze04261  Adrenergic signaling in cardiomyocytes
mze04310  Wnt signaling pathway
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101466566
   04310 Wnt signaling pathway
    101466566
   04020 Calcium signaling pathway
    101466566
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101466566
   04217 Necroptosis
    101466566
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101466566
   04916 Melanogenesis
    101466566
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101466566
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101466566
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101466566
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101466566
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 FTA2 Pkinase_fungal Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 101466566
NCBI-ProteinID: XP_004564317
LinkDB
Position
Unknown
AA seq 552 aa
MALTICTRFTDEYQLFEELGKGAFSVVRRCVKISSGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQIL
ESVHHCHVNGIVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWICQRSTVASMMHRQETVECLKKFNARRKLK
GAILTTLLVTRNFSAAKTLLNKKPDGVKVNNKANTVTSPKDTGPAPALEPQTTVIHNPVD
GNKESIESANTTIEDEDVKALRLGSLVSGILSSKSRSSQMSDSRQTPNSSVQTCTNNNKA
RKQEIIKVTEQLIESINNGDFEAYAKICDPGLTSFEPEALGNLVEGHDFHRFYFENALSK
GNKPVHTILLNPHVHLIGENAACIAYIRLTQYMDGSGMPRTMQSEETRVWHRRDGKWQNI
HFHRSGSPSIPH
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggcgttaacgatctgcacgagattcactgacgaatatcagctgttcgaggagctgggg
aagggcgccttctctgtggtcaggaggtgcgtaaagatctcatctggtcaggagtatgct
gccaaaatcatcaacactaagaagctatctgccagagatcatcagaagctggagagagag
gcgaggatttgtcgtttattgaagcaccccaacatcgtaagactccatgacagcatatca
gaagagggtttccactatctggtgtttgatctggtgacaggaggagagttgtttgaagat
atagtagcccgggagtactacagtgaggctgatgccagccactgcatacagcagatcctg
gagagtgtccatcactgccacgttaatggaatcgttcacagggacctgaagcctgagaac
cttctattggccagtaagctgaagggggcggcggtcaagttggctgactttgggctggct
atcgaggtacagggggaccagcaggcatggtttggttttgcaggcaccccaggctactta
tctccagaagttctgaggaaagacccatatgggaaaccagtggacatgtgggcctgtggt
gttattttgtacatcctgctggttggctaccctcccttctgggatgaggatcaacatcgc
ctctatcaacaaatcaaggctggggcctatgatttcccatcaccggagtgggacactgta
actcctgaggccaaagatctaattaacaagatgctaaccatcaaccccagtaaacgcatc
actgctgcagaggccctaaaacacccctggatctgccaacggtccactgtcgcttccatg
atgcacaggcaggagactgtggaatgcctgaagaaattcaatgccaggaggaaactcaag
ggagcaatattgaccactttgctagtcacaagaaacttctcagcagctaagactttgctc
aacaagaagccagatggcgttaaggtcaacaacaaagccaacacagtgaccagtcctaaa
gacactggccctgcccctgcactggaaccacagacaactgtgatacacaaccctgtggat
ggaaacaaggagtcaattgagagtgccaacaccaccattgaagatgaagatgtgaaagcc
cttcgtctgggcagcttagtgagtggtatcttgagttctaagagccgttcctcacagatg
tctgactcaagacagactcccaactcctcagttcagacctgcaccaataacaataaagct
cgaaaacaagaaatcatcaaagttactgagcagttaattgaatctatcaacaatggagac
tttgaggcctacgcgaaaatttgtgatcctggtttgacttcctttgagcctgaggccctg
ggcaacctcgtggaaggacatgacttccatcgcttttattttgaaaatgcattgtccaaa
gggaataagccagttcacaccatcctattgaacccacatgtgcaccttattggggaaaat
gcagcatgcattgcctatattcggctgacccaatacatggatggcagtggcatgcctcgc
accatgcagtctgaggagacccgagtttggcaccgccgtgatggaaagtggcagaacatt
cactttcatcgctctggctcgcccagcatcccccattaa

KEGG   Maylandia zebra (zebra mbuna): 101472930
Entry
101472930         CDS       T02814                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: calcium/calmodulin-dependent protein kinase type II subunit delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04114  Oocyte meiosis
mze04217  Necroptosis
mze04261  Adrenergic signaling in cardiomyocytes
mze04310  Wnt signaling pathway
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101472930
   04310 Wnt signaling pathway
    101472930
   04020 Calcium signaling pathway
    101472930
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101472930
   04217 Necroptosis
    101472930
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101472930
   04916 Melanogenesis
    101472930
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101472930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101472930
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101472930
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101472930
SSDB
Motif
Pfam: CaMKII_AD Pkinase PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2
Other DBs
NCBI-GeneID: 101472930
NCBI-ProteinID: XP_024657013
LinkDB
Position
Unknown
AA seq 422 aa
VTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAA
VKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYP
PFWDEDQHRLYQQIKAGAYDFPSPEWDTVXPEAKDLINKMLTINPAKRVTATDALKHPWI
CQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSAAKSLLNKKPDGVKINN
KTNVVTSPKEPVPTPSLEPQTTVIHNPADGNKESSESANTTIEDEDVRARKQEIIKATEQ
LIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGTDFHRFYFENALSKGKQPIHTILLN
PHVHLIGDDAACIAYIRLTQYIDSSGMPRTMQSEETRIWHRRDSKWQNIHFHRSGSPTVP
TN
NT seq 1270 nt   +upstreamnt  +downstreamnt
agtcactggtggcgagctgttcgaggacatcgttgccagggagtactacagtgaagctga
tgccagtcactgcattcagcagatcctagaggctgtgctgcactgccaccagatgggtgt
ggtccaccgcgacctcaagccagagaatctgcttctagccagcaagctgaagggcgctgc
agtcaagctggcagacttcggcctggccatcgaggttcaaggagatcagcaggcgtggtt
cggtttcgctgggacaccaggatacctgtctccagaggtgctgaggaaagatccctatgg
caagccagtggacatgtgggcctgcggagtgatcctctacatcttactcgtgggctatcc
tcccttctgggacgaggaccagcacaggctgtaccagcagatcaaagctggggcgtatga
ttttccctccccagagtgggacacggtgnaccccgaggccaaagacctgatcaataagat
gctgaccattaacccagccaagagagtgacggccaccgacgcactcaaacacccctggat
ctgccaacgctccactgtagcatccatgatgcacagacaggagactgtggagtgcctcaa
gaaattcaacgccaggaggaaactcaagggtgccatcctgacaacgatgctcgccactcg
aaacttctcagcagccaagagcctgctgaataaaaaaccggatggtgtcaaaatcaacaa
caagaccaatgtggtcaccagtcctaaagagcctgtccccactccttctctggagcctca
aaccactgttatccacaacccagctgatggaaataaggagtccagcgagagcgccaacac
gaccatcgaggatgaggacgtgagagctcgaaagcaggagatcatcaaggccactgagca
gctgattgaggccattaacaatggagactttgaagcctacacgaagatatgtgatcctgg
tctcacatcctttgaacctgaagccttgggtaacctggtggagggcacagacttccaccg
cttctactttgagaacgctctgtctaaggggaagcagcccatccacaccatcctgctcaa
ccctcacgtccacctcataggcgatgacgccgcctgcattgcctacattcgcctcaccca
gtacatcgatagcagcggcatgcctcgcaccatgcagtcagaggagactcgcatctggca
ccgccgtgacagcaagtggcagaatatccacttccaccgctccggctctcccaccgttcc
caccaactga

KEGG   Maylandia zebra (zebra mbuna): 101473593
Entry
101473593         CDS       T02814                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04114  Oocyte meiosis
mze04217  Necroptosis
mze04261  Adrenergic signaling in cardiomyocytes
mze04310  Wnt signaling pathway
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101473593
   04310 Wnt signaling pathway
    101473593
   04020 Calcium signaling pathway
    101473593
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101473593
   04217 Necroptosis
    101473593
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101473593
   04916 Melanogenesis
    101473593
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101473593
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101473593
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101473593
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101473593
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Kdo Pkinase_fungal SnoaL_2 DUF2613 SnoaL_4
Other DBs
NCBI-GeneID: 101473593
NCBI-ProteinID: XP_014266981
UniProt: A0A3P9C3M5
LinkDB
Position
LG7
AA seq 540 aa
MATTTCTRFTDEYQLYEELGKGAFSVVRRCVKLCTGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGFHYLLFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKCKNAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL
SPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTV
TPEAKNLINQMLTINPAKRITAQEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLK
GAILTTMLVSRNFSVGRQTTAPAAVSAVAGTTAGIVEQAAKSLLNKKADVKPQTNSTRNS
IVTSPKGNIPSAALEPQTTVIHNPVDGIKESSDSSNTTIEDEDVKARKQEIIKITEQLIE
AVNNGDFEAYAKICDPGLTSFEPEGLGNLVEGMDFHRFYFDNLLSKNSKPIHTTILNPHV
HIIGDDAACIAYIRLTQFVDGQGRPRSSQSEETRVWHRRDSRWQNVHFHCSGAPSAPLQG
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggcaacgactacttgcacacgttttacagatgaataccagctgtacgaggagcttggc
aagggggccttttcagtggtgcgtcgctgtgtcaaactttgtacaggccaagagtatgca
gccaaaatcatcaataccaaaaagctctcggccagagaccatcagaaactggagcgggaa
gccaggatctgcagattgctaaagcatcccaacattgttcgtcttcatgacagtatctct
gaggaaggcttccactatctcctctttgacctagtgacaggaggggagctgtttgaggat
attgtggctcgagaatactacagtgaagcagatgcaagtcattgcatccagcagatcctg
gaggccgtgctccactgccatcagatgggtgtggttcacagagatctcaagccagaaaac
ctgctgctggccagcaaatgtaagaacgcagcagtcaagttggctgattttggactggcc
attgaagtacaaggagaccaacaggcttggtttggctttgcgggtactcccggctacttg
tctccagaagtgctgaggaaagaagcatatggtaaacctgtagacatctgggcatgtggt
gtgatcctctacatccttttggttgggtaccctccgttctgggacgaggaccaacacaaa
ctctaccaacagatcaaagctggagcatatgattttccctccccagagtgggacacagtg
actcccgaggctaaaaatctgatcaaccagatgcttactattaatccagccaagagaatc
actgcccaggaggctctgaagcacccatgggtctgtcaacgctcaacggtggcctcaatg
atgcacagacaggagaccgtcgagtgcctgaagaaatttaatgccaggaggaaactcaag
ggtgccattcttactaccatgcttgtctccaggaacttctctgtgggccgtcagactacg
gcccctgctgctgtcagcgctgtagcaggaaccacagctggcatcgtggaacaagcagcc
aagagtctcctcaacaagaaggctgatgtcaagcctcaaacaaacagcacgagaaacagc
atagtcaccagtcccaaaggcaacatcccctctgctgcactggaacctcagactactgtt
atccataatccagtagatgggatcaaggaatcatctgatagcagcaacacaactattgag
gatgaagatgtgaaagctcgcaaacaggaaatcataaagatcacagagcagcttattgaa
gctgtcaacaatggagactttgaggcctacgcgaagatctgcgaccctggtctgacctca
tttgaacctgaggggctgggaaatctggtggagggaatggacttccacagattttacttt
gacaatctcctctcaaagaacagcaaacctatccacaccaccatccttaacccccatgtg
catataattggggacgatgctgcctgcatcgcctacatccgcctgacgcagttcgtggat
ggccagggccgtcctcgctcaagccaatctgaagagaccagggtatggcaccgcagggac
agccggtggcaaaatgtccacttccactgctcaggagctccttctgccccgctgcagggg
tga

KEGG   Maylandia zebra (zebra mbuna): 101474026
Entry
101474026         CDS       T02814                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04114  Oocyte meiosis
mze04217  Necroptosis
mze04261  Adrenergic signaling in cardiomyocytes
mze04310  Wnt signaling pathway
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101474026
   04310 Wnt signaling pathway
    101474026
   04020 Calcium signaling pathway
    101474026
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101474026
   04217 Necroptosis
    101474026
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101474026
   04916 Melanogenesis
    101474026
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101474026
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101474026
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101474026
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101474026
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2
Other DBs
NCBI-GeneID: 101474026
NCBI-ProteinID: XP_004556661
LinkDB
Position
LG8
AA seq 619 aa
MATTATSTRFTDEYQLYEELGKGAFSVVRRCVKKSSGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCISQI
LESVNHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAEQALKHPWICHRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQHTNSAAAASSTASLAQEACKSLLNKKSDSAKPSTNNSKNSI
VSAINALKDTNMATNAQMESQSTVVHNAPDGVKGSTESNATNDEEEMKGRKADSTALSQG
SATEEMPPLLPSPQSSPAIPPHDVKRIAWNSTGNSSYPESELSQSSIPAAPLGSNTVAAK
SNTKQTRKQEIIKITEQLIEAINNGDFDAYTRICDPGLTSFEPEALGNLVEGMDFHKFYF
ENLLSKNSKPVHTTLLNPHVHLIGEDAACIAYIRLTQFVDSTGRPRSSQSEETRVWHRRD
GKWLNVHFHCSGAPAAPLQ
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggcaaccaccgctacttccacccggtttactgatgagtaccagctatacgaggagctc
gggaagggagctttttcagtggtgcgtaggtgtgtaaagaaatcatcaggacaggaatat
gctgcaaaaatcatcaacactaagaagctgtctgcaagagatcatcagaagcttgagaga
gaggctcgtatctgccgtctcctgaaacaccccaacattgtgagactccatgacagcatt
tcagaggaaggctttcattacctagtctttgacctggtgacaggaggagagctttttgaa
gacattgtagccagggagtactacagtgaggctgacgccagtcactgcattagtcagatc
ttggagagtgtcaatcatatccaccagcatgatattgtgcacagagacctcaagcctgag
aacttgttgttggccagtaagatgaagggagccgcagtgaagctggcagactttggactt
gctattgaagtgcagggggaccagcaggcttggtttgggtttgcaggcactcctggctat
ctctcccctgaggtcctgcggaaggacccttatggcaagcctgtggacatatgggcctgt
ggtgttattctctatatcttgttagtgggatatccaccattctgggacgaagatcaacat
aaactctatcagcagatcaaagctggggcatacgatttcccgtctccagagtgggacacg
gtgaccccagaggcaaagaacctgattaaccagatgttgacaattaacccagccaaaaga
atcactgctgaacaggctctcaaacacccatggatctgccaccgttctacagtggcgtcc
atgatgcacagacaggaaacagtcgaatgtctccgcaagttcaatgctcgccgaaaactc
aagggagccattctcaccaccatgctggtgtccagaaacttctcagtgggccggcagcat
accaactctgctgctgccgcctcctccacggcctcactggctcaggaagcatgcaaaagt
ttactcaacaagaagtcagattctgctaagccttctaccaacaacagtaagaacagtata
gtgagcgccatcaatgccctgaaagacaccaacatggcaacgaacgcacagatggaatct
cagagcacagtggtgcacaatgctcccgatggcgtcaagggatcaacagaaagcaatgcc
accaacgacgaggaggaaatgaaaggtaggaaagcggacagtacggcgctgagtcagggc
agcgctacagaggagatgcccccacttctgccctcacctcaaagctcacctgccattcca
ccgcatgacgtaaagcgcattgcatggaacagcacaggcaacagctcctaccccgagtct
gaactctcacagtcatccatacctgccgctccactagggagcaacactgtcgctgctaaa
agcaacactaagcagactcgtaaacaggagatcatcaagattacggagcagctgattgaa
gcaatcaacaatggagatttcgatgcctacacgaggatttgcgatcctggactcacctct
ttcgaaccagaggctctgggaaacctggtggagggcatggactttcacaaattctacttt
gaaaacttgttgagcaaaaacagcaagcccgtgcataccaccctgctcaacccacacgtg
cacctgatcggcgaggacgccgcgtgcatcgcctacatccggctcacacagttcgtggat
tccaccggccgcccccgttccagccaatcagaggagaccagagtgtggcatcgccgcgat
ggcaagtggcttaacgtccacttccactgctctggagcgcctgctgcaccactacagtga

KEGG   Maylandia zebra (zebra mbuna): 101475499
Entry
101475499         CDS       T02814                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform X5
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04114  Oocyte meiosis
mze04217  Necroptosis
mze04261  Adrenergic signaling in cardiomyocytes
mze04310  Wnt signaling pathway
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101475499
   04310 Wnt signaling pathway
    101475499
   04020 Calcium signaling pathway
    101475499
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101475499
   04217 Necroptosis
    101475499
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101475499
   04916 Melanogenesis
    101475499
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101475499
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101475499
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101475499
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101475499
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Kdo Pkinase_fungal SnoaL_2
Other DBs
NCBI-GeneID: 101475499
NCBI-ProteinID: XP_004566710
LinkDB
Position
Unknown
AA seq 546 aa
MATTTCTRFTDEYQLYEELGKGAFSVVRRCVKLCTGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGFHYLLFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKCKNAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL
SPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTV
TPEAKNLINQMLTINPAKRITAQEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLK
GAILTTMLVSRNFSVGSRQTTAPASVTAAAAAVAAAAGTTAGLVEQAKTLLNKKADVKPQ
TNSTKNSIVTSPKGNIPSPALEPQTTVIHNPVDRTKESSDSSNTTVEDEDVKARKQEIIK
ITEQLIEAINNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHT
TILNPHVHLIGEDAACIAYIRLTQFVDGQGRPRSSQSEETRVWHRRDSKWQNIHFHCSGA
PAAPLQ
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggccacgacaacctgtacgcgattcacagatgaatatcagctgtacgaggagctgggg
aagggagcattttcagtggtgcgcagatgtgttaagctgtgcacaggacaggagtatgct
gctaaaataatcaacaccaaaaagttatctgcaagagatcaccagaagctggagcgagag
gctcgtatttgtcgtctgttgaaacaccccaacatcgttcgtcttcatgacagtatatca
gaggagggcttccactacctcctgtttgacttggtgaccggaggtgaactatttgaggac
atcgtagccagagagtattacagtgaggccgatgccagtcattgcatccagcagatcctg
gaggcggtgcttcactgccatcaaatgggcgtggtgcaccgggacctgaagccagagaac
ctgctcctggcaagcaagtgtaagaatgctgcagtgaaactggccgactttggcctcgcc
attgaggtgcagggggatcagcaggcctggttcggatttgctggcacaccggggtatctg
tcccctgaggttttgaggaaggaggcatatggcaaacctgtggacatctgggcctgtggg
gtgatcctctacatcctgctggtgggctaccctcctttctgggacgaggaccagcacaag
ctgtaccagcagatcaaggctggggcttatgatttcccatccccagagtgggacacagtc
accccagaggccaaaaacctgatcaaccagatgctgacgatcaacccagccaagaggatc
actgctcaagaggccctcaagcacccatgggtctgccaacgatccacagtggcatctatg
atgcacagacaggagaccgtggagtgcctgaagaaattcaatgccaggaggaaactcaag
ggggccattcttactaccatgctggtttctcgaaatttctccgtgggcagcaggcagacc
accgctccagcctctgtcactgcagctgcagcagctgtggctgcagccgccggcaccaca
gcagggctggtggaacaagccaagactttgctcaacaaaaaggcagatgtcaagccccag
acaaacagcaccaaaaacagcatagtcaccagccccaaaggaaacatcccttcacccgct
ctggaacctcagacaactgtcatccataatccggtggacaggacaaaggaatcgtcggac
agcagcaacaccactgtggaggacgaagatgtgaaagcacgcaagcaagaaattatcaag
ataaccgaacagctgatagaggccatcaacaacggagactttgaggcatacgctaagatc
tgcgaccctggactgacttcatttgagccggaggccctgggcaacctggtagagggaatg
gatttccacagattctactttgagaaccttttggctaagaacagcaagccgatccacacc
accatcctgaacccccatgtgcacctgatcggcgaggatgcagcctgcatcgcctacatc
cgcctgactcagtttgttgacggccagggtcggccgcggtccagccagtcagaggagact
cgtgtctggcatcgcagagacagcaagtggcagaacatccacttccactgctcaggcgca
ccagctgcgccactccagtaa

KEGG   Maylandia zebra (zebra mbuna): 101479352
Entry
101479352         CDS       T02814                                 

Gene name
camk2a
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04114  Oocyte meiosis
mze04217  Necroptosis
mze04261  Adrenergic signaling in cardiomyocytes
mze04310  Wnt signaling pathway
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101479352 (camk2a)
   04310 Wnt signaling pathway
    101479352 (camk2a)
   04020 Calcium signaling pathway
    101479352 (camk2a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101479352 (camk2a)
   04217 Necroptosis
    101479352 (camk2a)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101479352 (camk2a)
   04916 Melanogenesis
    101479352 (camk2a)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101479352 (camk2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101479352 (camk2a)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101479352 (camk2a)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101479352 (camk2a)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 SnoaL_2 SnoaL_4 APH Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 101479352
NCBI-ProteinID: XP_014266233
LinkDB
Position
LG10
AA seq 478 aa
MATVICTRFTEEYQLYEELGKGAFSVVRRCVKVLSGQEYAAKIINTKKLSARDHQKLDRE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVEGDQQAWFGFAGTPGYL
SPEVLRKDPYGKAVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPAKRITAAEALKHPWISHRSTVASCMHRQETVECLKKFNARRKLK
GAILTTMLATRNFSGGKSGSNKKADGVKESSESTNTTIEDEDTRGRKQDIIKVTEQLIEA
ISNGDFESYTKMCDPAVTAFEPEALGNLVEGLDFHRFYFENLWSKNSKPVHTTILNPHIH
LVGDEAACIAYVRVTQYIDSNGTPRTAQSEETRVWHRRDGKWQIVHFHRSGSPSTLSN
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcaacggtcatctgcactcgttttactgaagagtatcagctgtatgaggagctgggc
aagggagcattctccgttgtgcggcgctgcgtgaaggtcctgtcgggtcaggagtacgcc
gccaagatcatcaacaccaagaagctgtctgccagagatcatcagaagttggaccgtgaa
gctcgaatctgtcgactactgaaacaccccaacatcgttcggctgcatgacagcatctcg
gaggaggggcatcattacctcatctttgaccttgtgacaggtggagagctgtttgaagac
atcgtagcgagagaatactacagtgaagctgatgccagtcactgtatccagcagattttg
gaggcggtgctacattgtcatcagatgggcgtggtccacagagacctaaagcctgagaac
ctcctcctggcctccaagtccaaaggagcggcggtgaaactcgccgactttggcctcgcc
atcgaggtggaaggagaccagcaggcatggttcggctttgcggggactccaggttatctg
tctccagaggtcctcaggaaggacccatacgggaaagcagtcgacctctgggcctgtggt
gtgattctctacatcctattggtcggttatcctccattctgggatgaagaccagcatcgt
ctgtaccagcagatcaaagctggcgcctatgattttccttccccggagtgggacacggtg
actcctgaagccaaagatctcatcaataagatgctgaccatcaacccggccaaacgcatc
acagctgccgaggcgctcaaacacccctggatctctcaccgatccacagtggcatcctgc
atgcacagacaggaaacggttgagtgtctgaaaaagttcaacgccaggaggaaactgaag
ggagccattctcaccaccatgttggccaccaggaatttctctggaggaaagagcgggagc
aacaagaaggccgacggagtgaaggaatcctctgagagcacaaacaccaccatcgaggac
gaagacacccgagggaggaaacaggacatcattaaagtcactgagcagctcatcgaggcc
atcagcaacggagactttgagagctacactaaaatgtgcgacccggctgtgacggcgttc
gagcccgaggcgttggggaatctggtcgaaggcctggacttccaccgcttttactttgaa
aacttgtggtccaagaacagcaaaccggtgcacaccaccatcctgaaccctcacatccac
ctggtgggcgacgaggccgcctgcatcgcatacgtcagggtgacgcagtacatcgactcc
aacgggacgcctcgcaccgcccaatcggaggagaccagggtgtggcaccgccgtgacggg
aagtggcagatcgtgcacttccaccgctcaggctccccctccacgctgagcaactaa

KEGG   Maylandia zebra (zebra mbuna): 101480272
Entry
101480272         CDS       T02814                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04114  Oocyte meiosis
mze04217  Necroptosis
mze04261  Adrenergic signaling in cardiomyocytes
mze04310  Wnt signaling pathway
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101480272
   04310 Wnt signaling pathway
    101480272
   04020 Calcium signaling pathway
    101480272
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101480272
   04217 Necroptosis
    101480272
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101480272
   04916 Melanogenesis
    101480272
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101480272
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101480272
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101480272
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101480272
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 101480272
NCBI-ProteinID: XP_004570102
LinkDB
Position
LG13
AA seq 621 aa
MATVVTSTRFTDEYQLYEELGKGAFSIVRRCIKKSTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCINQI
LESVSHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQHTSPAATTSTAAMAQEACKTLLNKKSDGVKSQGNNSKNSVV
SSSSTKDSSMSSSAPMEAQTTVVHNPADGTKGSTESCNNIEEEEMKGRKAATSDSTSTDS
AGLTQSSTIEEQAQTPSPQCPPLTSGPLQEAVSSPSVPVAQPSPAQSSCPAPEFTLSPPT
GSSNLQQTRKQEIIKMTEQLIEAINNGDFEAYTRICDPGLTSFEPEALGNLVEGMDFHKF
YFENLLSKNSKPVHTTILNPHVHLIGEDAACIAYIRLTQYIDGQGRPRSCQSEETRVWHR
RDAKWLNVHFHCSGAPAAPLQ
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggctacagttgtaacctcgaccagattcacagacgaatatcagctgtacgaggaactc
ggaaagggtgccttctccatcgttcgtcgatgtatcaagaagtccaccggccaggagtat
gccgcaaaaattatcaacacaaaaaagctctcggccagagatcaccagaaattggagcgg
gaggcgaggatctgtcgcctgctgaaacatccgaacatagtacgactgcatgacagcatc
gcagaggaaggcttccattaccttgtctttgacctagtcactggaggcgagctgtttgag
gacattgtcgccagagagtactacagtgaagcagatgccagccactgcattaatcagatc
ctggagagcgtcagccacatccaccagcacgatattgtccacagggacctcaagccagaa
aatttgctcctggccagtaagatgaagggagcggcggtgaagcttgcagattttggcctc
gctattgaggttcaaggggaacagcaggcgtggtttggttttgcaggaactccggggtat
ctgtccccagaggtgttgagaaaggacccatatggcaagccagtggacatatgggcatgt
ggtgtgatcctgtatatcttgctggtgggctaccctccattctgggatgaggaccaacac
aaactctaccaacaaattaaggctggtgcttatgattttccttctcctgaatgggacaca
gtgacccctgaggccaagaatttgatcaatcaaatgttaacgattaaccccgccaaaaga
atcactgccgaccaggccctcaagcatccctgggtctgccaacgatccactgtggcctcc
atgatgcaccgtcaagagactgtggaatgtctgcgcaagttcaatgccagaaggaagctt
aaaggagctatcctcactacgatgctcgtgtccaggaacttttcagtgggacggcagcac
accagtcctgccgctaccaccagcacagccgcaatggctcaggaagcgtgtaaaacctta
ctaaacaaaaagtcggacggtgtgaagtcgcagggaaacaacagtaaaaacagtgtagta
agcagcagcagcaccaaagacagcagcatgtcatcttcagcaccaatggaagcccagaca
actgttgtacacaacccagcagacggcaccaagggctccactgagagctgtaataacatt
gaagaggaggagatgaaaggtaggaaagcggccaccagtgactctaccagtacagacagt
gcagggttaacacagtccagcactattgaggagcaggcgcagaccccgtctcctcagtgc
ccaccgctcacctctggtcccctgcaggaggctgttagcagccccagtgttcctgtagct
cagcccagcccagctcagagctcgtgtcctgcaccagagttcactctttcaccccccaca
ggcagcagcaacctgcagcagactcgtaaacaggagataataaagatgactgaacagctg
attgaagccatcaacaatggcgattttgaggcttacacgagaatctgtgatccaggacta
acttcttttgaaccggaggcccttggaaacttggtcgagggaatggactttcacaagttc
tactttgagaatcttctgagtaaaaacagcaaaccggtgcacaccaccatcctcaacccc
cacgtccatctgatcggcgaggatgccgcctgcatcgcctacattcgtctgacgcagtac
atagacggtcagggacggccgcgttcctgccagtctgaggagactcgtgtgtggcatcgc
cgtgacgccaaatggctcaatgtgcacttccactgctcaggggcgccagcggcacccctg
cagtga

KEGG   Maylandia zebra (zebra mbuna): 112429915
Entry
112429915         CDS       T02814                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta chain-like isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04114  Oocyte meiosis
mze04217  Necroptosis
mze04261  Adrenergic signaling in cardiomyocytes
mze04310  Wnt signaling pathway
mze04912  GnRH signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112429915
   04310 Wnt signaling pathway
    112429915
   04020 Calcium signaling pathway
    112429915
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112429915
   04217 Necroptosis
    112429915
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112429915
   04916 Melanogenesis
    112429915
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112429915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    112429915
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     112429915
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   112429915
SSDB
Motif
Pfam: CaMKII_AD Pkinase PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Mltc_N SnoaL_2
Other DBs
NCBI-GeneID: 112429915
NCBI-ProteinID: XP_024656989
LinkDB
Position
Unknown
AA seq 386 aa
MGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKD
PYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLI
NKMLTINPAKRVTATDALKHPWICQRSTVASMMHRQETVECLKKFNARRKLKGAILTTML
ATRNFSAKSLLNKKPDGVKESSESANTTIEDEDVRARKQEIIKATEQLIEAINNGDFEAY
TKICDPGLTSFEPEALGNLVEGTDFHRFYFENALSKGKQPIHTILLNPHVHLIGDDAACI
AYIRLTQYIDSSGMPRTMQSEETRIWHRRDSKWQNIHFHRSGSPTVPTKIKQQAAPPSHG
HLTTVWTKYSRTALNIQTRQSFPLTA
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgggtgtggtccaccgcgacctcaagccagagaatctgcttctagccagcaagctgaag
ggcgctgcagtcaagctggcagacttcggcctggccatcgaggttcaaggagatcagcag
gcgtggttcggtttcgctgggacaccaggatacctgtctccagaggtgctgaggaaagat
ccctatggcaagccagtggacatgtgggcctgcggagtgatcctctacatcttactcgtg
ggctatcctcccttctgggacgaggaccagcacaggctgtaccagcagatcaaagctggg
gcgtatgattttccctccccagagtgggacacggtgacccccgaggccaaagacctgatc
aataagatgctgaccattaacccagccaagagagtgacggccaccgacgcactcaaacac
ccctggatctgccaacgctccactgtagcatccatgatgcacagacaggagactgtggag
tgcctcaagaaattcaacgccaggaggaaactcaagggtgccatcctgacaacgatgctc
gccactcgaaacttctcagccaagagcctgctgaataaaaaaccggatggtgtcaaagag
tccagcgagagcgccaacacgaccatcgaggatgaggacgtgagagctcgaaagcaggag
atcatcaaggccactgagcagctgattgaggccattaacaatggagactttgaagcctac
acgaagatatgtgatcctggtctcacatcctttgaacctgaagccttgggtaacctggtg
gagggcacagacttccaccgcttctactttgagaacgctctgtctaaggggaagcagccc
atccacaccatcctgctcaaccctcacgtccacctcattggcgatgacgccgcctgcatt
gcctacattcgcctcacccagtacatcgatagcagcggcatgcctcgcaccatgcagtca
gaggagactcgcatctggcaccgccgtgacagcaagtggcagaatatccacttccaccgc
tccggctctcccaccgttcccaccaaaataaaacagcaggctgctcctccgtcacatgga
catctgaccacagtctggacaaagtattcgagaacagcgttaaacattcaaacgagacaa
agtttccctttaacagcttga

DBGET integrated database retrieval system