KEGG   Maylandia zebra (zebra mbuna): 101466826Help
Entry
101466826         CDS       T02814                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00010  Glycolysis / Gluconeogenesis
mze00030  Pentose phosphate pathway
mze00051  Fructose and mannose metabolism
mze00052  Galactose metabolism
mze01100  Metabolic pathways
mze01200  Carbon metabolism
mze01230  Biosynthesis of amino acids
mze03018  RNA degradation
Module
mze_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101466826
   00030 Pentose phosphate pathway
    101466826
   00051 Fructose and mannose metabolism
    101466826
   00052 Galactose metabolism
    101466826
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101466826
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mze01009]
    101466826
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mze03019]
    101466826
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101466826
Protein phosphatases and associated proteins [BR:mze01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101466826
Messenger RNA biogenesis [BR:mze03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101466826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101466826
NCBI-ProteinID: XP_004558747
LinkDB All DBs
Position
LG20
AA seq 780 aa AA seqDB search
MSEDLQPTVDPTKMGVGRSIAVLTSGGDAQGMNAAVRATVRVGIYTGAKVYFVHEGYQGL
VDGGENICLATWESVSMMLQLGGTVIGSARCKDFRTRDGRMKAACNLVKLGITNLCVIGG
DGSLTGANEFRTEWSGLLVDLVRAGKITEEEAKKSSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDAITTTAQSHQRTFILEVMGRHCGYLALVTALACGADWVFIPEMPPDDG
WEDHLCRRLSDQRARGSRLNVIIVAEGAMCKDGKPITSDQIKKLVTDRLGFDTRTTVLGH
VQRGGTPSAFDRILGSRMGVEAVMALLEATPDTPACVVTLSGNQAVRLPLMECVQVTKEV
TAAMAQGRFDDAIKLRGKSFENNWNTYKLLAHINPPDTKSNINVAIMNIGAPCAGMNAAV
RAAVRMGIIQGHSMLAVHEGFDGLAQGQIEPIIWTSVSGWTGKGGSMLGTKRTLPGKRLE
EISQNIAKFNIHALVIIGGFEAYVGGLELVQAREKYEEMCIPIVVIPATVSNNVPGSDFS
IGADTALNTITSTCDRIKQSAAGTKRRVFIVETMGGYCGYLATMAGLAAGADAAYIFEEK
FDIKDLEANVQHMVEKMKTTVKRGLVLRNESCNSNYTTDFIFNLYSEEGKGIFDCRKNVL
GHMQQGGTPTPFDRNFGTKMGAKAVLWLTDKLKECYRHGRIFANTADSACVLGMRKRALT
FQPLAELKEDTDFERRIPKIQWWLKIRPIMKILAKYDIKLDTSEHADLEHVIKKSSFLGK
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggacctccaaccaaccgtggaccccacaaagatgggggtcggacgatccatc
gccgtgctgacgtcaggaggagacgctcagggcatgaatgcagccgtgagagccacagtc
agagtcggcatctacactggagccaaagtctactttgtccatgagggctaccagggcctg
gtggatggaggagaaaacatttgtctcgctacatgggagagtgtgtctatgatgcttcag
ctgggtggtactgtcatcggcagcgctcgctgcaaggacttcagaaccagagacggtcgt
atgaaggccgcctgcaacctggtgaagctgggcatcaccaacctgtgtgtaatcggtgga
gacggcagtctgacgggagccaacgaattcaggaccgagtggagcgggctgctggttgat
ctggtccgagcaggtaagatcactgaggaagaagctaagaaatcgtcccacctcaatatt
gttggcatggtcggctcaatcgacaatgacttctgcggcactgacatgaccatcggtact
gactcggcactgcaccgcatcattgaagtggtggatgccatcaccacgactgcacagagc
caccagaggacatttatcctggaagtgatgggcagacactgtggttacctggccctggtg
acggctctcgcctgtggagctgactgggtgttcattcccgagatgccgccagatgatggc
tgggaggaccatttgtgcaggaggctgtcagaccaaagagcccgtggatctcgactaaat
gtgatcattgtggccgagggcgcgatgtgcaaggatggcaaaccgattacatctgaccag
atcaaaaagttggtaactgacagactcggctttgatacccgcaccactgttcttggacac
gtgcagagaggaggaacaccctctgccttcgacagaatcctgggcagcaggatgggagtg
gaggcggtgatggcattgctggaggccaccccagacactcccgcctgtgtggtcaccctg
tcggggaatcaagccgtcagattgccgctcatggagtgcgtgcaagtgacaaaagaagtg
actgctgccatggctcagggcagatttgacgatgccatcaagctcagaggaaagagtttt
gaaaacaactggaatacgtacaagctgctggctcacatcaatcctccagatactaagagt
aacatcaatgtggccattatgaatatcggcgccccctgtgctggtatgaacgctgccgtg
cgtgcagcggtgaggatgggcatcatccagggtcactccatgctggcagtccatgaaggt
ttcgacggtctggctcaaggacagatcgagcccattatctggacttctgtgagtggctgg
actggaaaaggaggttcaatgttgggcaccaagagaactcttccaggcaaaaggttggag
gagatcagccagaacatcgccaaattcaacatccacgctttggtgatcattggcggcttt
gaggcgtatgttggaggccttgagctggtgcaggctagggagaaatatgaggaaatgtgc
attcccattgtggttatccctgccaccgtatccaacaacgtccctggctctgactttagc
atcggcgctgacactgccctgaacaccatcacctccacctgtgacaggatcaagcagtct
gcagcaggcaccaagcgccgcgtgtttatcgttgagactatgggtggatactgtggctac
ttagccaccatggcaggtctggctgctggggctgatgccgcttacatctttgaggaaaaa
ttcgacattaaagatctggaggcgaacgtccagcacatggtggagaagatgaagacaaca
gtgaagagaggtctggtgctcaggaatgaaagctgcaattccaactacacgactgatttc
atcttcaacctgtactcagaggagggaaaaggcatctttgactgccgtaagaatgtcctt
ggacacatgcagcagggcggcactcctacacccttcgacagaaactttggcacaaagatg
ggtgccaaggcagttctgtggcttactgacaaactgaaggagtgctataggcatggtcgt
atctttgctaacacagcagactccgcttgcgtgctgggaatgagaaaaagggcactcacc
ttccaacctctcgctgaattgaaggaagacacagattttgagcgccgcatccctaagata
cagtggtggctgaaaatcaggcccatcatgaagatcttggctaaatatgacatcaaactg
gacacctctgaacacgccgacttggagcatgtgatcaagaagagtagctttcttgggaag
tag

DBGET integrated database retrieval system