KEGG   Maylandia zebra (zebra mbuna): 101466918Help
Entry
101466918         CDS       T02814                                 

Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00052  Galactose metabolism
mze00500  Starch and sucrose metabolism
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101466918
   00500 Starch and sucrose metabolism
    101466918
Enzymes [BR:mze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101466918
    3.2.1.20  alpha-glucosidase
     101466918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101466918
NCBI-ProteinID: XP_004561431
LinkDB All DBs
Position
LG14
AA seq 1307 aa AA seqDB search
MLMVMFTIMSVISIAFIVLFATGQSGVKEEITDTFVPTCPSMPLGERVDCFPDSGASQEI
CQERGCCWSPRDESNVPWCFFPTNYGYTVESQETPNSYAIKAKLTRMESPPLFGQHIKEL
AIDAEMQTKNRLRFKIYDPNNKRFEVPHEHILSLNPTPSSPINNTLQITQKPFGLTVRRE
ENQNVVFDTRMAPIVFEDQYIQLSAKLPSHNIYGLGEHVHRQYRHDTNWRTWPIFTRDAF
PNGGTHNLYGHYPFFLCLEDNSGKSFGVFLLNSNAMDVTLQPAPAVTYRTIGGVLDFYIF
FGDTPEQVVHEFLELIGKPVIPAYWSLGFQLSRWNYGNLSIVKETVERNRAVDLPYDIQY
TDIDYMEDKKDFTYDKVKFAELPQFAEFLHEKGQKYILILDPAIATSKRVGDALYESYDR
GTAKNAWVTEADGVTPLIGEVWPGEAVFPDYTSQACIDWWVDEYERFYREVKHDALWIDM
NEVSNFKQGSAKGCASNNLNYPPFIPNILDNLMYSKTLCMDAKQSWGNHYDVHSLYGYSM
VLASEKALQRVFGANRTLLLTRSSFPGVGKYSGHWLGDNGANWNDIKWAIPGMLEFGLFG
IPYIGADICGFFDDSTEELCRRWMQVGAFYPFSRNHNAEGYKPQDPAVYGADSALVRSSK
HYLNIRYTLLPYLYTLFYKAHTAGETVVRPVLHEFYSDSATWTVDRQFLWGKYLLITPVL
DPGVDKVSAYLPDARWYDYETMEQVGDRKRHVEMYLPAEKLGLHIRGGAILPTQKPNVTT
TYSRRNPMGLIIALDDHDSAAGELFWDDGDSRDTVKNSNYIHYKFTVTQGTLTMQVTNNG
YNDPNNLKFDNIIILGVPTVPASVSVTDVDATNTTTILDNNNIDYDGAKKVLTLQNLDLI
LGETYVVEWKVLRINCHPEDNADQAKCEARGCIWDPIAIEGAPNCIYPENYGYNVTSLRE
SNEGMTIDIIRNTKYRSSGRPQSRDIDTLRVDIKYHSSDMLQFKIYDPNDDRYEVPVELS
VPTTPETEESNRLYRVAIVKYPFGIQIIRNSTGTIIWDSSVPGFTFSDMFIQVTTRLPSH
YVYGFGETEHKTFKHDLNYHTWGMFSKDQPPGYKMNCYGVHPFYMGLENTADAHGVLLLN
SNAMDVTLLPSPALTYRTLGGILDFYVFMGPTPEMVVQEYTQLIGRPVLPAYWSLGFQLC
RYGYANDKEIETLYTEMKTAGIPYDVQYADIDYMERQLNFVLDKDFQGLPALVDSMRDEG
MRFIFILDPAISGNETQPYPAFERGIAADVFIKWPQTISDGIVWGKV
NT seq 3924 nt NT seq  +upstreamnt  +downstreamnt
atgttaatggtgatgtttacgattatgagtgttatatcaatcgcattcatagttcttttt
gccacgggacaatctggtgtgaaagaagaaattacagatacatttgtgccaacatgtccc
agcatgcctctgggtgagagagtagattgcttccctgattctggagcatcacaggagata
tgtcaggaacgtggctgttgttggagtccacgggatgagagtaatgttccctggtgtttc
ttcccgaccaactatggatatactgtggaatcacaggagacaccaaattcttatgctata
aaggcaaaactgacaagaatggaatctccacctctatttggtcaacacataaaggaactg
gcaattgacgcagaaatgcagacaaagaatcgactcagatttaagatttatgatcccaac
aataagaggtttgaagtcccccatgagcacatccttagcctcaaccctacaccatccagt
cccatcaacaacacactgcagatcacacagaaaccctttggccttactgtacgcagagag
gagaaccaaaacgttgtgtttgacactagaatggctccaattgtgtttgaagaccagtac
atacagctgtctgctaagctcccatcccataatatttatggcctgggggagcatgtccat
aggcaatatcggcatgacacaaactggagaacctggccaattttcacaagagatgctttt
cctaatgggggaacacataacctctatggacactatccctttttcctctgtctggaagat
aatagtgggaagtcatttggggtgtttctcctgaacagcaatgctatggatgtgacactg
cagcccgccccagctgtgacctacaggacaattggaggggtgcttgacttctacattttc
tttggtgacacaccagaacaagtggtgcatgaattcctcgagctcattggcaagcctgtc
attcctgcctactggtcactgggattccagctttctcggtggaactatggcaacctcagt
atagtcaaggaaacagtggagaggaaccgtgctgtggatcttccatatgacattcaatat
actgacatagactacatggaggataaaaaggatttcacctatgacaaggtgaagtttgca
gaacttccacagtttgctgaattcctccatgagaaggggcagaaatatatccttatcctg
gatccagcaatagccaccagtaagagggttggggatgctctgtatgagtcctatgaccgt
ggaactgcgaaaaatgcttgggtcactgaagcagatggagtgactcctctaataggagag
gtgtggccaggagaggctgtatttccagattacaccagccaagcctgcatagattggtgg
gtggatgagtatgagcgattctacagggaggtcaaacatgatgcactgtggattgacatg
aatgaggtctctaatttcaagcaaggatcagcaaagggctgtgcttcaaacaacctcaac
taccctccattcattccaaacattctcgacaacttgatgtacagtaagactctgtgtatg
gatgccaagcagtcttggggaaaccattatgatgtccacagtctgtacgggtactctatg
gtgctggctagtgaaaaagctctgcagcgtgtttttggagcaaaccgtaccctgttgctg
acccgctcctcctttccaggtgtgggaaaatattcaggtcactggctgggggacaatggt
gccaactggaatgacataaaatgggctatccctggcatgctagagtttggcctctttgga
ataccctatattggagctgacatctgcggtttctttgatgactccactgaggagttgtgt
cgtcgctggatgcaggtcggggctttctaccccttcagtcggaaccacaacgctgagggg
tacaagcctcaggatccagctgtatatggtgctgactcagcactggtccggagttccaaa
cattacctgaacatacgttatacacttctgccttacctctacacgctattctacaaagcc
cacactgcaggagagactgttgtacgtcctgttctgcatgagttctattctgacagcgca
acctggacagtagatcgccagttcctctggggaaaatacctgctcatcacacctgtattg
gatccaggtgtggataaggtgtcggcatatctacctgatgctcggtggtacgactacgag
acgatggaacaagtgggagaccgcaaaaggcatgttgaaatgtacctaccagcagagaag
cttggattacacatcaggggtggagcaatcctcccaacacagaagcctaatgtcaccaca
acatacagtcggcgtaatcccatgggtttgatcattgctcttgatgaccatgacagcgca
gctggagagctattttgggatgacggtgattcccgagacacagttaagaatagcaactac
atccactacaagttcactgttacccagggaacactgacgatgcaggtgaccaacaatggt
tacaatgacccaaacaaccttaagtttgacaacattattatccttggggtacctactgtc
cccgcatccgtctctgtgactgatgttgatgctacaaacactactacaatattagataac
aacaatatagactacgatggagccaagaaggtgctgaccctgcagaaccttgacttgatc
ttgggggagacgtatgtggtagagtggaaagtactacgtattaactgtcatccagaggac
aatgcagatcaggctaagtgtgaggccagaggctgtatctgggatccaattgccattgaa
ggtgccccaaattgcatctatccagaaaactatggttacaatgtcacatcattaagggaa
agtaatgaggggatgacaattgatatcattcggaacacaaagtacaggagcagtggccgt
ccacagtcccgtgatattgacacactccgtgttgacattaaatatcacagcagtgacatg
ctgcaattcaagatctatgacccaaatgatgatcgctatgaggtaccagtggagttgtcg
gttcctacaactcctgagactgaagagagcaataggctttacagggtcgctattgtcaag
tacccattcggcatccagattattaggaatagcaccgggactataatttgggattcatct
gtgccaggttttaccttctcagacatgttcatccaagtgacaactagactgccatctcat
tatgtttatggttttggggaaacagagcataaaacttttaagcacgatctaaactatcat
acctggggtatgttctccaaggaccagcctcctggttacaagatgaattgctatggagtc
catcccttctatatgggtcttgagaatacagctgatgctcacggtgtgctgctgctaaac
agcaatgctatggatgtgactttactgcctagtccagctttaacctaccgaactctggga
ggcatcctggatttctacgtgttcatgggtccgacgcctgagatggtggtgcaggagtac
actcaattgattggacgacctgttctacctgcctattggtcccttgggttccagctctgt
cgctatggttacgcgaatgacaaggaaatagaaacgctatacacagaaatgaagacagct
ggtatcccctatgatgtgcagtatgcagacattgactacatggagcgtcagcttaacttt
gtcctggacaaagactttcaaggactgcctgccctggttgatagcatgagagacgagggc
atgaggttcatcttcattctggatcccgccatctcaggtaatgagacccagccctatcca
gcttttgagagagggatagcagcagatgttttcatcaaatggccccaaaccatcagtgat
ggcattgtgtgggggaaggtgtga

DBGET integrated database retrieval system