KEGG   Maylandia zebra (zebra mbuna): 101466977
Entry
101466977         CDS       T02814                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04210  Apoptosis
mze04620  Toll-like receptor signaling pathway
mze04621  NOD-like receptor signaling pathway
mze04622  RIG-I-like receptor signaling pathway
mze04623  Cytosolic DNA-sensing pathway
mze04625  C-type lectin receptor signaling pathway
mze04920  Adipocytokine signaling pathway
mze05132  Salmonella infection
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101466977 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101466977 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101466977 (ikbkg)
   04621 NOD-like receptor signaling pathway
    101466977 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    101466977 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    101466977 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    101466977 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101466977 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101466977 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101466977 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101466977 (ikbkg)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101466977 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10
Other DBs
NCBI-GeneID: 101466977
NCBI-ProteinID: XP_004573522
UniProt: A0A3P9D5I0
LinkDB
Position
Unknown
AA seq 621 aa
MVQPQPDGPMQWEMSGEESGGTLRVPPELAANEVVTRLLSDNQQLREALRRSNLALRQRC
EEMEGWQRRTKEEREFLSCRFQEARSLVERLAQENHSLQSMVNGPGSSNTSSNHCCSSSQ
TENPQLRTARNGPVDGPQTLDQREKKRVEDTEQCTQTSPPRSLDNTSVHSSLSYAQSSPP
ISFSDELGDIMGNDNSQPVEGANEFLQLLKSHKEKLEEGMRELRRKNEELEKQRDEGEKE
KERMLHCIDQLRGKLAQAQTNNVTEEVVQQRSEAQHSSDCSSLAKLTEQLQATQGRYREL
EEKLDYLQKSSAQRDRTEALLKQKDKDCAQLAKDCEALKAQATSLLGELQERQSWLDKSE
HERVLLEDKLSSKIKALQVAERELEQQKKQHHVAMDKLLLQTQSLEQALKSERHVVTEEK
KKLTQLQHAYTCLFRDYDSKLKNEGGDLCCRLEEAERALALKQDLIDKLKEEVEQQKGSL
ETIPVLTAQAEIYKADFLAEREAREKLNQKKEELQEQLNQALAENERLKQEATARARMEQ
MKMRHLDDFSARPTLIPPPQGVFPPFNTVPPAPSFRTPGLGPVGDQGPVGTEELPDLCCP
KCQYLAPDMDTLQIHVMDCIQ
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggtgcagccacaacccgatggccccatgcagtgggagatgtccggagaagagagtgga
gggaccctgagggtcccaccagagcttgcagccaatgaagtggtgaccagattgttgagt
gacaaccagcagcttagagaggcgctgcggcggagcaacctggccttgcgtcagcgctgt
gaggagatggagggatggcaacgaaggacaaaagaggaacgagagtttctcagctgtcgc
ttccaagaagcaaggtccctggtggagaggctggcccaggagaaccactccttacagagc
atggtgaacggacctggctcctccaacacctcgtctaatcactgctgcagctccagccag
actgaaaacccgcagctacggacagccaggaatggaccagtggacggaccacagactcta
gatcagcgagaaaagaagagagtcgaagatacagagcaatgcacacagacatcaccgcct
cgcagcctggataacacaagtgtgcatagctcattgagttacgcacaatcctctcccccc
atatcattttcagatgaactgggagatataatgggcaatgacaatagccagcctgtggaa
ggtgcaaacgagttcctgcagctgctgaagagccacaaagagaaactggaggaagggatg
cgagagctgagaaggaaaaatgaggagctagagaagcagagggacgagggagagaaagag
aaggagcgaatgcttcactgcatagaccagctccggggtaaactggcccaggcacagacg
aacaatgttactgaggaggttgtccagcagcgctctgaggcacagcactcgtccgactgc
tctagcctggctaagctcacagagcaacttcaggccacacagggcaggtatcgggagctg
gaggagaagcttgattacctgcagaagagctcagctcagagggacagaactgaagccctg
ctcaaacagaaggacaaggactgtgcccagctggccaaggactgcgaggccctgaaagct
caggcaacttccctgctaggagaactacaggaaagacaaagctggttggacaaaagtgag
catgaacgcgtactcctggaagacaaattaagcagtaaaataaaggccctgcaggtggca
gagcgggagcttgaacagcagaagaaacagcatcatgtagccatggacaagctgctgctg
caaacccagagcttggagcaggccctgaagtcagagagacatgttgtcactgaggagaag
aaaaaactgacacagctacagcatgcatacacgtgtctctttagagactatgattctaaa
ctgaagaatgagggtggagatctgtgctgccgactggaggaggctgagcgagcgctggcc
ctgaagcaggacctgattgataaactgaaggaagaggtggagcaacagaaaggctccctg
gaaacaattcctgtccttactgcacaggctgagatctacaaggcagatttccttgctgag
cgagaagccagagagaagttaaaccagaaaaaggaggagctgcaggagcagctgaatcag
gccttggctgagaatgagaggcttaaacaggaagctaccgcacgtgcacgtatggaacaa
atgaagatgagacacctggatgacttctctgcacggcccacactcatcccccccccacaa
ggtgtgttcccccctttcaacacggtgccccctgctccctcattccgtactccgggattg
ggaccagtcggtgatcaaggtccagtcggaactgaggagctgccggatttatgttgtcct
aagtgccagtacctggctccagatatggacacactgcagatacatgtaatggactgtata
cagtaa

DBGET integrated database retrieval system