KEGG   Maylandia zebra (zebra mbuna): 101467298
Entry
101467298         CDS       T02814                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04068  FoxO signaling pathway
mze04110  Cell cycle
mze04115  p53 signaling pathway
mze04218  Cellular senescence
mze04310  Wnt signaling pathway
mze04340  Hedgehog signaling pathway
mze04371  Apelin signaling pathway
mze04510  Focal adhesion
mze04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101467298
   04340 Hedgehog signaling pathway
    101467298
   04371 Apelin signaling pathway
    101467298
   04068 FoxO signaling pathway
    101467298
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101467298
   04115 p53 signaling pathway
    101467298
   04218 Cellular senescence
    101467298
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101467298
   04530 Tight junction
    101467298
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101467298
NCBI-ProteinID: XP_004556280
LinkDB
Position
LG7
AA seq 293 aa
MEPQLWCCEGDGPPIPRAYRDSNLLTDRVLHALLRVEDMYLPAPNYFKCVQREISPYMRR
IVAAWMLEVCEEQKCEEEVFPLAMNYMDRILSVEPTKKNHLQLLGAACMFLASKLKETIP
LTAEKLCIYTDNSVTPSQLLQMELLVLNKLKWDLASPTPLDFIDHFLSQLPVNKENKSTL
RKHAQTFVALCATDVKFIASPPSMVAAGSMVAAVEGLQMRMVGNTMMSQKLTEQLAQTIK
SDPDCLRACQEQIESLLETSLRQAQQQHSFAMETKKMGEDHSATPTDVRDINI
NT seq 882 nt   +upstreamnt  +downstreamnt
atggagcctcagctgtggtgctgcgagggggatgggcctcctataccgagagcctaccga
gactccaacctgttgactgaccgggtcctgcacgctctgctgcgggtagaagacatgtac
ctccccgctcctaactactttaaatgtgtccagagagagatatctccgtacatgaggagg
atagtcgctgcttggatgttagaggtgtgcgaggagcagaaatgtgaggaggaggttttc
cccttagctatgaactacatggatcgcatcttgtcagtggaacccacgaagaagaaccat
ctgcagctgttgggagctgcctgcatgttcctggcatctaaactaaaggagacaatccca
ctgactgcggagaaactctgcatctacactgataattcagtcacaccttctcagttgctg
cagatggagctgctggttttgaataagctgaagtgggacctggcttcacccacccctctt
gatttcatcgaccacttcctgtctcagctgcctgtcaacaaagagaacaagtcgacactg
aggaagcacgctcagacctttgttgcactgtgtgccacagatgtcaaattcatagccagc
cccccatccatggtggcagcaggcagcatggtggcagcggtagagggcttacagatgaga
atggtgggtaacaccatgatgtctcaaaaactgacagaacagctggctcagaccatcaaa
agtgacccggattgtttgagagcatgtcaggaacagatcgagtctttgctggaaaccagc
ctcagacaggcgcagcagcagcactcatttgccatggaaactaagaaaatgggagaggac
cactcagcgacgcccacagatgtacgagacattaacatctga

DBGET integrated database retrieval system