KEGG   Maylandia zebra (zebra mbuna): 101467306Help
Entry
101467306         CDS       T02814                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00052  Galactose metabolism
mze00500  Starch and sucrose metabolism
mze01100  Metabolic pathways
mze04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101467306 (gaa)
   00500 Starch and sucrose metabolism
    101467306 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101467306 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101467306 (gaa)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101467306 (gaa)
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101467306 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101467306
NCBI-ProteinID: XP_004558392
LinkDB All DBs
Position
LG4
AA seq 935 aa AA seqDB search
MGLLSHFTVAVLLFAFSLLACLFMNRFFTSEARLQIGSVRDEQHDITAHGRLVYNPAKPQ
NNSSRGIHPERSQKCNISRGSECAMALESRFDCGRDKLLSQSECEDRGCCYAPLLDSAGP
PWCFYPRVYPGYKMGPLIPTPRGQGATLTRASPSYLPKDISTLRLDDIQETADCFHLTLK
DPSSQRYEVHLPGGVPQSKANTQSVLYTTEYQSDPFGFMVRRKSNGRVIMNTTVAPLLFA
DQYLQLSTTLASSFVSGLGEHYTSLLLDLNWTSLTLWNRDMAPHADANLYGSHPFYIVQE
EDGLAHGVFLLNSNAIEVILQPTPALTWVSTGGILDLYIFLGPDPQSVIRQYLQIIGYPM
MPSYWSLGFHLCRWGYTTTNTTRKVAQSMHDENFPMDVQWNDLDYANKRRVFTFDPWRFG
DLPEMVEEFHKRGMKYILILDPGISSSSTPGMYPPFDDGLKRDVFIKNATGQILIGKVWP
GPTAFPDFTNPDTRQWWEDCIRDFHSKVPVDGLWIDMNEPASFVQGSVEGCPDSDLENPP
YTPSVVGGRLNSGTLCMSARQKMSFHYNLHNLYGLTEAYATHSALLKIRRKRPFVLSRSS
FPGIGRFSGVWTGDVRSDWEQLRFSIPAVLQFSLFGVPLVGADICGFGGNTTEELCVRWM
QLGAFYPFMRNHNDKPNAAQEPYVFGQRAQAAMRSALYLRYSLLPFLYTLFHHAHASAET
VARPLFMEFPNDPNSQTIDKQFLWGSSLLISPVLEQGAVELAAYLPPATWYSLHNGQPFY
SKGQFLLLPVPLDTINVHVREGHIIPQQEPALTTTASRNNPFFLTVALSAGGWARGDLFW
DDGESVDTFEMQNYCYVIFSAEQSQVVSNPLKLNGALDSLVLGGLQVFGVPSPPRYILAN
GEKVRDFTYRTDTKVLAVTSLALPMSEVFTVQWVL
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgttgtctcacttcactgtagccgtgctcctcttcgcattttctttattagct
tgtttgttcatgaaccgctttttcaccagtgaagcccgactacagattgggtcagttcgg
gatgagcaacatgacatcacggcacatggacggcttgtttataatcccgcaaagccacag
aacaattcaagtcggggtatacaccctgaaagatcccagaaatgtaatatttccagagga
agtgaatgcgccatggccctagagagtcggtttgactgtggcagggacaaactgctcagc
cagagcgagtgtgaggacagaggatgctgctacgcccctctgcttgactccgcaggacca
ccctggtgcttttacccccgtgtgtatcctggctataaaatgggacccctcatacctact
cctcggggtcagggtgccacactgactcgtgccagcccctcctacctccccaaagatatc
tccactctaagactagatgacattcaagagacagcagactgtttccacctcacattaaag
gacccatcatctcagcggtatgaagttcatctgccaggcggtgttcctcagagcaaagcc
aatacacagagtgtcctctataccactgaataccagtctgacccatttggctttatggtg
cgacggaaatccaatggaagggtgattatgaacaccacagttgctcctctgctgtttgct
gaccagtacctgcagctgtctaccacactggcctcttcttttgtgtctggccttggggaa
cattacacctctctcctcttggatctaaactggacttccctgactctctggaatagagac
atggcacctcatgctgatgccaacctctatggctcccacccattttacatagtacaggaa
gaggatggcttagcacatggagttttccttctaaatagcaatgcaattgaggtgattcta
cagccgacccctgctctcacctgggtgtccaccggtggaatcctggatctctacattttc
ttgggtcctgaccctcaaagtgttatacgacagtaccttcagatcattggctatcctatg
atgccttcttattggtcgctgggctttcatctgtgccgctggggttacacgaccactaat
acgacccgaaaggttgcacaaagcatgcatgatgaaaactttccgatggatgtacaatgg
aatgacctggattacgcaaacaagcgaagggtattcacctttgacccctggagattcggg
gatctgccagaaatggtggaggagtttcacaagagaggcatgaagtacatccttattctg
gacccagggataagcagcagcagcaccccaggaatgtaccctccctttgatgatggactt
aaaagagatgtctttatcaaaaacgctacagggcaaatcctgatagggaaggtttggcca
ggcccaacagcctttcctgacttcacgaacccagacaccagacaatggtgggaagactgc
atcagagattttcactctaaagttcctgtagatggtctctggattgatatgaacgaacca
gccagttttgtgcagggctcggtggagggctgtcctgacagtgaccttgagaacccacca
tacacaccaagtgtcgttggaggacggttaaactcaggaaccctctgtatgtcggctcgg
cagaagatgtcatttcactacaacctgcacaatctttacggactcacagaagcttatgca
acacacagtgctttgctgaagatacggaggaagagaccctttgtgctgtcacgctcctct
ttccccggcatcggacgcttttctggagtgtggacaggagatgtcaggagtgactgggag
cagctcagattctcaattcctgcggtgctgcagttcagcctgttcggggtccctctggtg
ggagcggacatatgcggctttggaggcaacaccactgaggagttgtgcgttcggtggatg
cagcttggggccttctacccatttatgaggaaccacaatgacaagcccaatgctgctcaa
gagccctatgtgtttgggcagcgggcccaggcagccatgcggagtgcgctgtatctccgt
tactccctactgccgttcctttacacactcttccaccatgcacacgcctctgctgaaact
gtggccagacctctattcatggagtttcccaatgaccctaacagtcagaccatagacaaa
cagttcctgtgggggagttcacttcttattagtccagttttagagcaaggggctgtagaa
ctggctgcatacctgccccccgccacttggtacagcctgcacaatggtcagcctttctac
agtaaagggcagttcctgctcctgccagttcctctggacaccatcaatgttcatgtgagg
gaaggacacatcattccccagcaggagcctgctttgacaaccacagcctcacgcaacaac
cctttcttcctgactgtggcgctgtcagcgggcggctgggcccggggcgacttgttttgg
gatgatggcgagagcgtcgacacttttgaaatgcaaaattattgctacgttatcttctct
gctgaacagtctcaggttgtgagtaaccctctaaagctgaatggggcactggacagtctg
gtgctgggagggctgcaggttttcggggtgccttcaccacctcgctacattttagcaaat
ggggagaaagtcagggactttacatatcgcactgacaccaaggttttagcagtgactagt
ctggccttacccatgtcagaagtgtttacggtccagtgggttctctaa

DBGET integrated database retrieval system