KEGG   Maylandia zebra (zebra mbuna): 101467818
Entry
101467818         CDS       T02814                                 

Gene name
grb2
Definition
(RefSeq) growth factor receptor-bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04150  mTOR signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101467818 (grb2)
   04012 ErbB signaling pathway
    101467818 (grb2)
   04068 FoxO signaling pathway
    101467818 (grb2)
   04150 mTOR signaling pathway
    101467818 (grb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101467818 (grb2)
   04540 Gap junction
    101467818 (grb2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101467818 (grb2)
   04912 GnRH signaling pathway
    101467818 (grb2)
Membrane trafficking [BR:mze04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    101467818 (grb2)
Domain-containing proteins not elsewhere classified [BR:mze04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   101467818 (grb2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH2 SH3_2 SH3_10 SH3_3 SH2_2 SH3_4 hSH3 DUF5093 Mucin_bdg
Other DBs
NCBI-GeneID: 101467818
NCBI-ProteinID: XP_004563051
UniProt: A0A3P9B754
LinkDB
Position
LG4
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGDVLKVLNEECDQNWYKAEQDGREGFIPKNYIQMKPHPW
FFGKIPRAKAEEMLNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNDLVEYHRLNSVSRNQQIFLRDIEQVPQNPTYVQALFDFDPQEEGELGFRRG
DFIQVLDNSDPNWWKGGCHGQTGMFPRNYVTPVSQNM
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggccattgccaaatacgatttcaaagctactgctgatgatgagcttagtttcaaa
cgtggagatgtcctcaaggtattaaatgaagagtgtgatcaaaactggtacaaggcagag
caggatggaagagaaggcttcatccccaagaattacatacagatgaaaccccatccgtgg
ttctttgggaagattccccgtgccaaagcagaggagatgctaaacaaacagaggcatgat
ggcgctttcctcatcagagagagcgagagtgcaccgggggatttctctctgtctgtgaag
tttggaaatgatgtccagcacttcaaggttcttcgtgacggagctgggaagtatttccta
tgggtggtgaagtttaactccctcaatgacttggtggaataccaccgcttgaactcagtc
tcccgcaatcagcagatctttcttcgagatatagagcaggtcccccagaatcccacatat
gtgcaggcgctcttcgactttgacccccaggaggaaggcgaattgggtttccgacgcggc
gacttcattcaagtcctggacaactctgaccccaactggtggaaaggaggctgccacggc
caaacgggcatgttccctcgcaactacgtcacgcctgtcagtcagaacatgtaa

KEGG   Maylandia zebra (zebra mbuna): 101477192
Entry
101477192         CDS       T02814                                 

Definition
(RefSeq) GRB2-related adaptor protein 2 isoform X1
  KO
K04364  growth factor receptor-bound protein 2
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04150  mTOR signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101477192
   04012 ErbB signaling pathway
    101477192
   04068 FoxO signaling pathway
    101477192
   04150 mTOR signaling pathway
    101477192
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101477192
   04540 Gap junction
    101477192
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101477192
   04912 GnRH signaling pathway
    101477192
Membrane trafficking [BR:mze04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    101477192
Domain-containing proteins not elsewhere classified [BR:mze04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   101477192
SSDB
Motif
Pfam: SH3_1 SH3_9 SH2 SH3_2 SH2_2 PaRep2a RNA_pol_Rpb5_C NADH_dhqG_C
Other DBs
NCBI-GeneID: 101477192
NCBI-ProteinID: XP_004556406
UniProt: A0A3P9DAX9
LinkDB
Position
LG4
AA seq 220 aa
MEAKGKFDFNAVTDDELGFKQGDIVKIIRYDNIWCKAEMNGQEGLVPRNFLDIHFPRWFR
EDATRGDAVEFLMNKHVGEFVIRGCRTSPGNFCISVKYEQGMMHYRLLRDKRGHYFLWSE
KFTSLNKLVDFYKTNSISKSRIIYLNVNGSLDQGGPSDDQPTTSCFQVMAMCDFPAIQDD
ELGFNAGDVIEVLDMSHPFWWKGKLKGIIGLFPVNATRPL
NT seq 663 nt   +upstreamnt  +downstreamnt
atggaagccaaaggaaagtttgactttaatgcagtaacagatgatgagctgggcttcaaa
cagggcgacatagtcaagattatacgttatgacaacatctggtgtaaagcagagatgaat
ggacaggaggggcttgtgccacgtaacttccttgacattcattttccaagatggtttcgg
gaggatgccactcgtggagatgcagtggaattcctgatgaacaaacacgtgggagagttt
gtgatccgagggtgtcggaccagccccggaaacttctgcatttctgtcaagtatgagcag
ggcatgatgcattacagattgctgagggacaagagaggtcattacttcctgtggagcgaa
aaattcacctctctgaacaaactggtggacttctacaaaaccaactcaatctccaaaagc
aggataatctacctcaacgtcaatgggagcctggaccaaggcggcccctccgatgatcag
ccaactacgtcttgttttcaagtgatggcgatgtgcgacttccctgctatacaagacgac
gagcttggtttcaacgcaggagacgtcattgaggtgctggatatgtctcatcctttttgg
tggaaagggaagctgaaaggaattattggactgtttcctgtaaatgccacgagaccactg
tga

DBGET integrated database retrieval system