KEGG   Maylandia zebra (zebra mbuna): 101467929
Entry
101467929         CDS       T02814                                 

Gene name
erbb4
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-4 isoform X3
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101467929 (erbb4)
   04012 ErbB signaling pathway
    101467929 (erbb4)
   04020 Calcium signaling pathway
    101467929 (erbb4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101467929 (erbb4)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101467929 (erbb4)
Protein kinases [BR:mze01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101467929 (erbb4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Orthoreo_P10
Other DBs
NCBI-GeneID: 101467929
NCBI-ProteinID: XP_004562623
UniProt: A0A3P9CCJ2
LinkDB
Position
LG23
AA seq 1406 aa
MKFFPACVLVTLAVIGSCAAQSVCPGTENKLSTLSDLDQQYRTLKKLYENCEVVMGNLEI
TSIDRNRNLSFLKSIKEVTGYVLVALNQFDYLPLENLRIIRGTKLYEGRYALAIFLNYRR
DGLYGLRQLGLRNLTEILNGGVYVDQNKFLCHADTIHWRDIIKNPQAELLVVPSNNSNNG
CRRCHRSCNGRCWGHQEDQCQTLTKTVCAEQCDGRCFGPYVSDCCHRECAGGCSGPKDTD
CFACTNFNDSGACVTQCPQPFVYNPTSFQLEHNPRAKYTYGAFCVKKCPHNFVVDHSSCV
RACPSNKMEVEENRIKMCIPCTDICPKVCDGIGTGSLQSAQTVDASNIDKFVNCTKINGN
LIFLITGIKGDMYHGIGPLDPERLNVFRTVKEITGYLNIQSWPENMTDLSVFSSLATIGG
RALYSGSGISLLILKQRWISSLQFQSLSEISAGNVYIFNNSRLCFYNTINWTSLFRTPSQ
KVLVRNNQDPKECIQQRMVCDRMCSDDGCWGPGPDQCLSCRYFKRGRTCVQSCNLFDGEE
REFANGSVCLACDSQCEKMDGNTVTCLGPGPDQCVKCLHFKDGPNCVEKCPDGLQGANSF
IFKYAKANNECHPCHANCTQGCVGPRLQDCVGMMDRTPLIAAGVIGGLFIIVILALSVAV
YVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKILGSGAFGTVY
KGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ
LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKS
PNHIKITDFGLARLLDGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWEL
MTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAE
FCRMARDPQRYLVIQGDDRMKLPSPNDSKFFQSLLDEQDLDDLMDAEEYLVPRGFNMATQ
SCTTRPRVDPNRNQFGYRDGGPNAAEGPLAGTQACVNQDATGGPSPVLEDQRCNGSLHKK
SLSQAGGEDSGGQRYSADPTIFLGERALRGDTDEDGYMTAMKDKSSSEYLNPIEENPFVT
RRKNGEIHALDNPGYHSTPNSQPKGEDEYINEPLYLNTFHTPAELGLEALRRNGLPLPTQ
PPSSISATTSGSHLPLTIQTSLPHYPLPTAQPSPSGIPCHHGPPTHILHAHHTVKPAGQP
GNPGGSSVAQSQAGTTAQAQVSQSGALSTSATIGHGSLPAYQSYATTHPASLLKHGGQTS
GKASGKKLKVTFDNPEYWQHSLPPKSSNQAASDGAQGGSTNAKLFYKQNGHIRPAVAENP
EYMSEFSLKAGTILPPPPYRQRNTVV
NT seq 4221 nt   +upstreamnt  +downstreamnt
atgaagttcttcccagcttgcgtcctcgtcactttggcggtgatcggatcctgtgcggcg
caatcagtttgtcctggtacagagaacaaattgagcacactctcagacctggaccagcag
taccgcaccctgaagaagctctacgagaactgcgaagtcgtcatggggaatctggagatt
accagcattgatcgaaaccgcaacctctccttcctcaagtctatcaaagaagtgaccggt
tatgtgctggtggcacttaatcagttcgactacctgccactggagaacctgcggatcatc
cgaggcaccaaactttacgagggtcggtacgctctggccatcttcctgaactacagacgg
gacggtctgtacggactaaggcagctgggattacgtaacctcacagagatactgaatggg
ggcgtttatgttgaccagaacaaattcctgtgtcacgcagacaccatccattggcgtgac
attatcaagaacccccaagctgagctgctggtggtgccgtccaacaacagcaacaatgga
tgcagacgctgtcatcgctcatgcaacggacgctgctggggccatcaggaggaccagtgt
caaactttgacaaaaacggtgtgtgcagagcagtgtgacggtcgatgcttcgggccttac
gtcagcgactgctgccatcgcgaatgcgccggcggctgctccggccccaaggacacggac
tgctttgcttgcaccaatttcaacgacagcggggcctgcgtgacccagtgccctcagccc
tttgtgtacaacccgacgtccttccagttagagcacaaccccagggcgaagtacacctat
ggagccttctgtgtcaagaaatgtccacataactttgtcgtggaccacagctcctgtgtg
agagcatgtcccagcaacaagatggaagtggaggagaaccggattaaaatgtgcatccct
tgcacagacatctgtccaaaagtgtgtgacggtataggaacaggaagcctgcagtcagct
caaacagtggacgccagcaatattgataaatttgtcaactgcaccaaaatcaatggcaac
ctcatctttctcattactggcattaaaggggatatgtatcacggtattgggcctttggac
cctgagcgcctcaacgtgttccgcaccgtgaaagagatcacaggttacctcaacatccaa
tcctggcctgaaaacatgacagatcttagtgttttttccagcctggctaccattggaggc
agagctctttacagtggaagtggtatttctcttttgatcttgaagcagcgttggatctcc
tcactccagttccagtcgttgagtgagatcagcgccgggaacgtctacatcttcaacaac
agccgcctctgcttctataacactatcaactggacgtcgctatttaggaccccgagccaa
aaagtcctcgtccgtaacaaccaagatccaaaggagtgcatccaacaacgaatggtgtgt
gaccgaatgtgttcggacgatggctgttggggaccagggccagaccagtgcctctcttgc
cgatatttcaagcgaggccgtacctgcgttcagtcctgcaacctttttgatggggaagag
cgtgaatttgccaatggatccgtgtgcctggcgtgcgatagccaatgtgagaagatggat
ggaaacactgtgacatgtctcggtccgggcccagaccagtgtgtaaaatgcctccacttc
aaagacggccctaactgcgtagagaagtgccccgatgggctgcagggagccaacagtttc
atcttcaaatacgccaaggccaacaacgagtgtcatccctgccatgccaattgcacccag
gggtgcgtcgggccaagactccaagattgtgttgggatgatggacaggacacccctgata
gcagctggagtcatcggcggcctattcatcatcgtcattctggcgctcagcgtggccgtt
tatgttcgccgcaaaagcatcaaaaagaagagggccttgcggcgtttcctggagacagag
ctggtggagcccctgacccccagtggaactgctccaaaccaggcccagctgcggatcctg
aaagagacagagctgaagagggtgaagattttgggttcgggagctttcggaacagtctac
aagggcatctgggtcccagaaggtgagacggtgaagatccccgtggctattaaaatcctc
aatgagaccaccggtcctaaagccaacgtggagttcatggacgaggccctgatcatggcc
agcatggagcacccccacctggtgcgtctcctcggtgtctgcctgagccccaccatccag
ctggtcacccagctcatgccccacggctgcctcctcgactatgtgcacgagcacaaggac
aacattggatcgcagctgctgctcaactggtgtgtccaaattgcaaagggaatgatgtac
ctggaggagaggaggctggtccacagggacctggcagctcggaacgtgctggtaaagtct
cccaatcacatcaagatcaccgacttcggcctagcccgactgctggacggcgatgagaaa
gaatacaacgcagacgggggaaagatgcccattaagtggatggctctggagtgcatccac
tacaggaagttcacccatcagagtgacgtgtggagctacggagtgaccatctgggagctg
atgacatttggaggcaagccttacgatgggatccccacgcgagaaatcccagacatcctg
gaaaaaggcgagcgcctgccccagccgccaatttgcaccatagacgtctacatggtcatg
gtcaaatgctggatgattgatgcagacagcaggccgaagttcaaagagctggccgccgag
ttctgcagaatggcccgtgacccacagcgatatctggtgattcagggagacgaccgtatg
aagcttcccagtcccaatgacagcaagttcttccagagcctgctggacgaacaggacctt
gatgacttgatggatgccgaggagtatctggtgcctcgaggtttcaacatggccactcag
tcatgcacgaccaggcctcgtgttgaccccaacaggaatcaatttggctatcgagatggt
ggtccaaatgctgcagaaggacccttggcaggcacacaagcttgtgtgaaccaggatgcc
acaggtggcccgagcccagtcctggaggaccagcgttgtaatggaagcctgcataagaag
agcctgagccaggctggaggggaagacagtgggggtcagaggtacagtgctgatccaacc
atctttctgggagagagagcattgagaggggacactgatgaggacggatacatgacggca
atgaaggacaagagctcctcagaatatctgaatcccattgaggagaacccgtttgtcacg
cgacgtaaaaacggcgagatccacgccctggataacccaggctaccacagcacacccaac
agtcagcccaaaggagaggacgagtacatcaatgagcccctctacctcaacaccttccat
acccccgctgagctgggcctggaagccctgaggagaaatggtctgcccctacccacccaa
cctccttcttctatctcagccacaacctcaggctcccatctcccgcttaccatccagact
agcctgccccactaccccctccccacagcccaaccatctccatctggtattccttgccat
catggtccaccgactcacatcctccatgcccaccacaccgtcaaacctgcagggcaacct
ggcaatccaggtggcagctctgttgctcagagtcaagcaggaactactgctcaggctcag
gtgagccagtcgggcgccctgtccacttcagccaccattgggcatggcagcctgccagcc
taccagagctacgccaccacacaccctgccagtttgctgaagcatggagggcaaacatca
ggtaaagccagcggaaagaagctgaaggtgacctttgacaatccagaatactggcagcac
agcttgcctcccaaatcatctaaccaggcagcctcagatggtgcccagggaggttccacc
aacgccaagctcttctataagcagaatggacacatacggccggcagtagctgaaaaccct
gaatacatgtctgagttttccctgaaagctggaaccatcttgccacctccaccttaccgg
cagcgaaacactgtggtctag

KEGG   Maylandia zebra (zebra mbuna): 101478875
Entry
101478875         CDS       T02814                                 

Definition
(RefSeq) receptor tyrosine-protein kinase erbB-4
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101478875
   04012 ErbB signaling pathway
    101478875
   04020 Calcium signaling pathway
    101478875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101478875
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101478875
Protein kinases [BR:mze01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101478875
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like EphA2_TM
Other DBs
NCBI-GeneID: 101478875
NCBI-ProteinID: XP_004555579
LinkDB
Position
LG16
AA seq 1374 aa
MKPTTAQCCFGFLLTCLLFGFSFSQSVCAGTENKLSTLSDLEQQYRTLRKYYESCEVVMG
NLEITSIDRSRDLTFLRSIREVTGYVLVALNQFDYLPLENLRIIRGTKLYEDRYSLAIFL
NYRRDGNFGLRQLGLKNLTEILNGGVYVDQNKFLCHADTIHWQDIVKYPRIQPVVVPTNS
SVTCQKCHRSCNGRCWGPKEDQCQSLTKTVCAEQCDGRCFGPFVSDCCHRECAGGCYGPK
DTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPRAKYTYGAFCVKKCPHNFVVDHS
SCVRACPSNKMEVEENRIKMCIPCTDICPKACDGIGTASLQTAQTVDSNNIDKFVNCTKI
NGNLVFLITGIKGDIYHNIEALDPEKLNVFRTVREITGFLNIQSWPDNMTDLGVFSNLAT
IGGRALYSGISLLVLKQPGITSLQLQSLREISAGNVHIAENSQLCYYNTVNWTRLFRTTN
QKVLIRNNRSPQECSKEHMVCDPLCSDAGCWGPGPDQCLSCRYFSRGRTCVESCNLYEGD
IREYASGSVCVECDAQCERADGDSLTCLGPGPEHCVKCLHFKDGPNCVEKCPDGLQGANS
FIFKYAEANNECHPCHANCTQGCIGPRLQDCIGWMDRTPLIAAGVIGGLFMVVIMVLCVA
VSVRRKNIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKILGSGAFGTV
YKGIWVPEGETVKIPVAIKILNEATGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTI
QLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVK
SPNHIKITDFGLARLLDVNEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWE
LMTFGGKPYDGISTRDIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAA
EFTRMARDPQRYLVIQGDDRMKLPSPSDSKFFQSLLDEEELDDLMDAEEYLVPHSFNIPP
LAYTPRTRMDSNKNQFGCQDPSFSMEDMLAAVPRVISGPPVTGSCLAPQELASGGKIVGG
FGRGSQDDPRCNGTLRKQASPRSSTLEAGSTLTTVQGGGEDSNGQRYSADPTGLLSERGA
KGNAMRDKSNSDYLIPVEENPFVTRRRNGDAHTVIDGASCHTLHLAGATAAPKSQSTHGD
DEYVNEPLYLNTLLNTGAKNGLAGTVSISGSGSSVAQSVLQTVNPPTSSHTISSTGYVVP
PGHLPHPSYPSHTLHSGHSGHALHSGITSGTIMFDKKGKKATFDNPEYWQHSLPPKSSLH
NPEYLQDCSTRFFYRQNGRIRPAVAENQEYLSEAAMKTGNVLPPPPYRQRNTVV
NT seq 4125 nt   +upstreamnt  +downstreamnt
atgaaaccaacgactgcccagtgttgcttcggctttcttctgacttgcctcttgtttggg
ttcagcttttcacaatcagtatgtgctggaacggagaacaagctgagcacgctgtcggac
ctggagcagcagtatcgcactctgaggaaatactatgagagctgtgaagttgtaatgggc
aacctcgagatcacaagcattgaccgcagtcgtgacctcaccttcctcagatctatcagg
gaagtgacaggctatgtgttggtggctctgaaccagtttgactacctgccattagagaac
ttgagaatcatccgaggaaccaagctatacgaggaccgctactcccttgcaatcttcctc
aattacagacgtgatggaaactttggcctgcgccagttgggtctaaaaaatctcacagaa
atcctaaatggaggtgtttatgttgaccaaaacaagttcttgtgccatgcggacacaatc
cattggcaagatatcgtcaagtacccaaggatccaacctgtggtggtgcccaccaacagc
agtgtcacatgtcaaaaatgccaccgttcctgcaatggccgttgctggggacccaaagag
gaccagtgccaaagcttaactaagacagtgtgtgcggagcagtgtgacggccgttgcttt
ggtccctttgttagtgactgctgccaccgtgagtgtgcaggtggctgttatggcccaaag
gacacagactgctttgcctgcaccaactttaatgacagtggggcatgtgtgacccagtgc
cctcagccatttgtctacaaccctaccaccttccagctggagcataaccctagggcaaag
tacacctatggagctttctgcgtcaagaagtgtccacataactttgtggtagaccacagc
tcctgtgtgagagcatgccccagtaacaagatggaggtggaggagaatcgcattaagatg
tgcatcccttgtactgacatctgtccaaaagcatgtgatgggataggcacagcaagccta
cagactgctcagacagtggactccaacaacattgacaagtttgtcaactgcaccaaaatc
aatggcaacctggtgttcctcattactggaatcaaaggggatatctatcataacattgaa
gcgttggacccggaaaaactcaacgtgttccgcaccgttcgggaaattacaggttttcta
aacattcagtcatggcctgacaacatgacagacttgggtgttttctccaacctggctact
attgggggaagagcattgtacagtgggatctctctgctggtgttgaagcagccggggatc
acatcacttcagcttcagtctctgagagagatcagtgctgggaatgtccacattgcagag
aacagccagctttgctactataacaccgtcaattggacaagactgttccgtactacaaac
caaaaggttcttattcgcaacaaccgaagtccacaggaatgctccaaggagcacatggtg
tgtgacccactgtgttcagatgctggatgttggggtcccggcccagaccaatgcctgtcc
tgtcgatatttcagtcgtggacgaacgtgtgtagaatcctgcaatctctatgagggggat
attcgagaatatgccagtgggtcagtgtgcgtagagtgtgatgcccagtgtgaaagagct
gacggtgactctttgacctgtcttgggccgggcccagagcattgtgtgaaatgccttcat
ttcaaagacggtccaaactgtgtggaaaagtgtcccgatggcctgcaaggtgctaacagc
ttcatcttcaagtacgctgaagccaacaacgaatgccacccctgccatgctaactgcacc
caagggtgcattggaccgagacttcaagactgcatcggctggatggacagaacccctctg
attgcagcaggcgtaatcggaggactcttcatggtggtgatcatggtactctgtgtagca
gtgtctgtgcgacggaagaacattaagaaaaagagggcccttcgccgcttcctggagaca
gagttggtggaacctttaacacccagtggaacggcacccaatcaagcccagcttcgcatc
ctgaaagaaacagaactcaaaagagtcaagatcctcggctccggagcttttggaactgtt
tacaagggtatctgggtcccagagggggaaactgtgaaaatccctgttgccattaaaatc
ctaaatgaggccacaggacccaaggctaatgtggaattcatggatgaggctctgatcatg
gctagcatggagcacccgcacctggtccgactgctgggtgtctgcttgagtccgacaatc
cagctggtcacacagctgatgcctcacggatgcctgctcgactatgtccacgagcacaaa
gacaacattggatcacagctattgctcaattggtgtgtccagatagccaagggaatgatg
tatctagaggagcgtaggctcgtccacagggatttggcagcccgaaatgtcctggtcaaa
tctcccaaccacatcaagatcactgactttgggctggctcgcctgttggatgtcaatgaa
aaagaatataatgctgatggaggaaagatgcccatcaaatggatggcccttgagtgtatt
cattacaggaagtttactcatcagagtgacgtttggagttatggtgtaaccatttgggag
ctgatgacctttggagggaagccatatgatgggatttctacaagagatatcccagatctg
ttagagaagggagagcgtcttcctcaaccacccatctgcaccattgatgtttacatggtc
atggtcaaatgctggatgattgatgcagacagtcgacccaagttcaaggagctggctgcc
gagttcactcgaatggctcgagatccccaaagatatctggtcatccagggtgatgatcgc
atgaagctccccagccccagtgacagcaagttcttccagagcctcttggatgaggaggaa
ctagatgacctgatggatgctgaggagtacttggtgccccactccttcaacatcccccca
ctggcatacactccccgcacaaggatggactccaacaagaaccaatttggctgtcaggat
cccagtttcagcatggaggatatgctggctgccgtgccgagagtgatctctggtccccct
gttactggaagctgcctcgctccacaggaacttgcctcaggaggaaaaatagttggtgga
tttggccgtggtagccaggatgacccccgctgtaatggcactctgagaaaacaggcatcc
ccaaggtcaagcacccttgaggctggctcaactctcaccacagtgcaaggcggaggtgag
gacagtaatggacagcgttacagcgccgatcccactggtcttttatcagagcgaggagca
aaaggcaatgccatgagagacaagagcaattcagattatctcatccctgtagaggaaaac
ccctttgttacacggcgtaggaatggagatgcccacacagtgattgatggagctagctgc
cacactctgcatttggctggagccactgctgcccccaaaagtcaatccactcatggtgat
gatgagtatgtcaacgagccactgtacctgaataccctcctcaacactggggccaagaat
ggattggctggcacagtctccatctctggctccggatcctctgttgcacaatcagtactg
cagacagtcaacccaccaacatcaagccacaccatctcctccactggatatgtggtaccc
cctggccacctcccccacccatcgtatccatcacacaccctgcattcggggcattcagga
cacgctctgcactcaggcatcaccagcggcaccattatgtttgataagaaaggcaagaaa
gccacttttgacaatcctgaatactggcagcacagtctccctcccaagtcctcactgcac
aatcctgagtacctgcaggactgcagcacacgcttcttctaccgccagaatggacgcatt
cgccctgctgtggctgaaaaccaggaatacttgtcagaggctgctatgaaaacaggcaat
gtattgccaccccctccatacagacagaggaacactgtggtgtag

DBGET integrated database retrieval system