KEGG   Maylandia zebra (zebra mbuna): 101467996Help
Entry
101467996         CDS       T02814                                 

Gene name
tec
Definition
(RefSeq) tyrosine-protein kinase Tec
  KO
K07364  tyrosine-protein kinase Tec [EC:2.7.10.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101467996 (tec)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101467996 (tec)
Protein kinases [BR:mze01001]
 Non-receptor tyrosine kinases
  TEC family
   101467996 (tec)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 PH SH3_1 BTK SH3_9 SH3_2 PH_3 Kinase-like SH3_3 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101467996
NCBI-ProteinID: XP_014267246
UniProt: A0A3P9CWG5
LinkDB All DBs
Position
Unknown
AA seq 643 aa AA seqDB search
MSADLLLEELLIKRSQQKKRTSPLNYKERLFVLTKSRLTYYDGRAEKKFKRGSIEVSRIR
CVEIVKNGGGVIPCQNKYPFQVVYDTNTLYVFAPSHESRSRWVQSLKEEIKDNAEVLVKF
HPQFWQDGLWLCCRQAEKQALGCEQYNPLEDISRKPLPPIPGEKCKKERRRTPPPAPPTP
EDDEEDDEEAEEEEVVVAMYDFPGMEPHDLSLVKGEEYVIVDKCDVNWYRARNKYNEEGY
IPSNYVTEKKSGNLVQYVWYNKNVNRNKAEELLRKEDKEGAFIIRNSSTPGTYTVSLYTK
SSGDGGAAIKHYHIKETQTLPKHFYLAEKHLFSSIPDLIEYHKHNAAGLVARLRYPVGKQ
DKSAPSTAGFSYEKWEIDPNELTFMKELGCGQFGVVRLGKWRAQHKVAIKALKEGAMYEE
DFIEEAKVMMKLSHPKLVQLYGVCSQQRPIYIVTEFMEQGCLLNYLRQRRGSFNQGCLLS
ICLDVCEGMAHLEANGFIHRDLAARNCLVNDSLVVKVSDFGMTRYVLDDQYTSSSGAKFP
VKWSPPEVFNFCKYSSKSDVWSYGVLMWEVFTEGRMPFEQSPNHEVVTLVTQGHRLYRPK
MAKPAIYDTMQMCWYERTEDRPSFANLCVMISEALEDDEATPN
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggacctgctgctggaggagctgctaatcaagcgttcgcagcagaagaagagg
acgtcgccgctgaactacaaggagaggctgttcgtcctcaccaagagccggctgacatat
tacgatggaagagctgagaagaagttcaagaggggctccatcgaagtgagtcgcatcaga
tgtgtggagattgtcaagaatggaggaggggtcatcccctgccagaacaaataccccttt
caggtggtgtacgataccaacaccctctatgtatttgctccaagtcatgaaagcagaagt
cgatgggtccagagcctcaaagaagagatcaaagacaacgcagaggtcttggtgaagttt
caccctcagttctggcaggatgggttgtggctctgctgccgccaggcagaaaaacaagca
ctggggtgcgagcagtacaacccgttagaagacatttccagaaaacctctacccccgatt
cctggagagaagtgtaaaaaagagaggcgtcggactcctcctcctgcccccccgaccccc
gaagatgatgaggaagacgatgaggaggctgaggaagaggaggtggtcgtggctatgtat
gacttccccggcatggagcctcatgatctgagtctggtgaaaggggaagagtatgtcatc
gtggataagtgtgacgtcaactggtacagggcacgcaacaagtataatgaggaaggatac
attccaagtaactatgtaactgagaaaaaatccggaaacttggtccaatatgtctggtac
aataaaaatgtcaacaggaataaagctgaggagctgctgaggaaggaggataaagaagga
gccttcattattagaaactccagcaccccaggaacctacactgtttcgctctacaccaag
tcttcaggggatggaggtgcagctattaaacattaccacatcaaggagacacaaacccta
ccaaaacacttctacctggctgagaaacatctcttcagctccatcccagacctgatcgaa
taccacaaacataatgcagcaggtcttgtagccaggttgagatatcctgttggaaaacaa
gacaaatcagctccatccactgctggcttcagctatgaaaagtgggagattgaccccaat
gaactaaccttcatgaaggagctgggctgcggtcagtttggagtagtgaggctcggcaag
tggagagctcaacacaaagtggccatcaaggcgttaaaggagggagccatgtatgaggaa
gacttcattgaggaggccaaggttatgatgaaactgtcccaccccaaactggtacagttg
tacggggtgtgcagccagcagcggccaatctacattgtcacggagttcatggagcagggc
tgcctgttgaactacctcaggcagcggcggggcagctttaaccaggggtgcttgctgagt
atctgtttggatgtctgcgagggcatggcacacctggaagccaacggcttcatccacaga
gacttggcagccagaaactgtctggtaaacgactctctagtggtgaaagtgtctgacttt
ggcatgaccagatacgtgttagatgatcagtacaccagctcatcaggcgccaagtttcct
gtgaagtggtcacctcctgaagtctttaacttttgcaaatacagcagcaagtcggacgtc
tggtcatacggtgtgttgatgtgggaggtcttcacagagggtcggatgccatttgagcaa
agccccaaccatgaggtggtgacattagttacacagggtcatcgcctgtacaggcccaaa
atggccaagcctgccatctatgacaccatgcagatgtgttggtatgagaggacagaggac
cgtccctcattcgccaatctttgcgtaatgatctccgaagctctggaggacgacgaggca
actccaaactga

DBGET integrated database retrieval system