KEGG   Maylandia zebra (zebra mbuna): 101468035
Entry
101468035         CDS       T02814                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101468035 (cdkn1b)
   04068 FoxO signaling pathway
    101468035 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101468035 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101468035
NCBI-ProteinID: XP_004563877
UniProt: A0A3P9BUC0
LinkDB
Position
LG7
AA seq 184 aa
MSDVRLSNGSPTLERTDSRLSEHPKPSACRSLFGSVDHEELKRDLKGHLRELEERASDHW
GFDFATDTPRANSRFEWKLVDCRDLPGFYTRQPLTKKGVCSTGNNNVDLNGNHSCVVVPP
SEDPDRADGQMECTEQCTALRKRHACHDSPVPSKRSHSSSDVSCPSRSHSAEHTPRKTSP
KRKT
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactttcaaacgggagcccgacgctggagcggacggactcacggctg
tctgaacacccgaaaccgtcagcctgcaggagcctcttcggctcggtggatcacgaagag
ttaaagagggatttaaagggacatttgcgggagttggaagagcgcgcctccgaccactgg
ggcttcgacttcgccactgacacgccgagggccaactccaggttcgagtggaaactagtg
gattgcagagacctgccgggcttctacactcggcagccgcttacgaagaaaggcgtctgc
tccactgggaataacaatgtggatcttaacgggaatcacagttgtgttgtggtgcctccg
agcgaagatcccgacagggctgacgggcaaatggagtgcacggaacagtgtacagcgctg
aggaaaagacacgcgtgtcacgactcccctgttccgagcaagaggtcacacagcagctca
gatgttagttgtccgagtcggagtcactctgcagagcacacgcccagaaagaccagtccc
aagaggaaaacgtga

DBGET integrated database retrieval system