KEGG   Maylandia zebra (zebra mbuna): 101468171Help
Entry
101468171         CDS       T02814                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00010  Glycolysis / Gluconeogenesis
mze00053  Ascorbate and aldarate metabolism
mze00071  Fatty acid degradation
mze00280  Valine, leucine and isoleucine degradation
mze00310  Lysine degradation
mze00330  Arginine and proline metabolism
mze00340  Histidine metabolism
mze00380  Tryptophan metabolism
mze00410  beta-Alanine metabolism
mze00561  Glycerolipid metabolism
mze00620  Pyruvate metabolism
mze01100  Metabolic pathways
Module
mze_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101468171 (aldh2)
   00053 Ascorbate and aldarate metabolism
    101468171 (aldh2)
   00620 Pyruvate metabolism
    101468171 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101468171 (aldh2)
   00561 Glycerolipid metabolism
    101468171 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101468171 (aldh2)
   00310 Lysine degradation
    101468171 (aldh2)
   00330 Arginine and proline metabolism
    101468171 (aldh2)
   00340 Histidine metabolism
    101468171 (aldh2)
   00380 Tryptophan metabolism
    101468171 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101468171 (aldh2)
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101468171 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101468171
NCBI-ProteinID: XP_004571368
LinkDB All DBs
Position
LG11
AA seq 547 aa AA seqDB search
MVLLSPPAATFTHISRVCSSLSRCSAAGIMLRAVLFRSLPTLRRLPVCHYSAAAIPAPST
QPEVHYNKLFINNEWHDAVSGKTFPTINPATGEVICQVAEADEADVEKAVKAASNAFRLG
SPWRRTDASHRGVLLNRLADAIERDAAYLAELETLDNGKPYAVAYAVDLPTVVKVFRYYA
GWADKWEGKTIPIDGDYFCYTRHEPIGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKV
AEQTPLTALYVASLIKEVGFPEGVVNILSGMGPTAGAAIARHMDVDKVAFTGSTEVGHLI
QQASGSSNLKKVTLELGGKSPNIILSDADMEYAVEQSHFALFFNQGQCCCAGSRTYVQAD
VYDEFVERSVERAKKRVVGDPFNLKTEQGPQIDQEQFNKILGYISSGKREGAKLMCGGGI
AADRGYFIQPTVFGDVQDNMTIAREEIFGPVMQILKFKTLEEVVTRANDTKYGLAAAVFT
KDIDKANYVSSGLRAGTVWINCYDVFGAQAPFGGYKASGVGRELGQYGLDNYTEVKTVTI
KVLQKNS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgctcagcccccccgccgcgaccttcacccacatctcccgtgtttgcagctcg
ctgtctcggtgttcagcagcaggaatcatgcttcgcgctgtgctttttcggagccttcca
acactaagacgactgccggtctgtcactactctgcagccgccatcccagcacccagcacc
cagccggaggtccactacaacaagctctttatcaacaatgagtggcatgatgcagtgagt
gggaaaacgtttcctacgataaatccggcaactggtgaagtcatctgtcaggttgcagaa
gctgatgaggcagatgtggagaaggcagtgaaagcagcaagtaatgccttcaggttggga
tcaccatggcgacggacggatgcctctcatcgtggcgtgctgctgaacagattggctgat
gctatagagagagatgctgcctacctcgctgagcttgagacccttgacaatgggaagccc
tatgctgttgcctatgcagtggatctgcccacagtagtgaaagttttcagatattatgca
ggctgggccgacaaatgggagggaaagaccatccccatcgatggagattatttctgctac
actagacatgaacccattggagtctgtggacagatcataccgtggaacttccctctgctg
atgcaggcgtggaaacttggccctgccttagcaactggtaacactgtggtcatgaaggtc
gcagagcagacgccactcactgcgctttatgtagccagcctaatcaaagaggtgggtttt
cctgaaggtgttgtgaatatcctgtctggcatgggaccaacagctggtgctgccattgca
aggcacatggatgtcgacaaggtggcttttactggatccacagaggtgggtcatctaatc
cagcaggcttcaggcagcagcaacctgaagaaagtcactttggagctgggaggaaagagc
cccaacatcatcctgtctgatgccgacatggagtacgctgtggagcagtcccacttcgct
ctgtttttcaaccaaggccagtgttgctgtgctggctctcgaacctatgtccaagccgat
gtctacgatgagtttgtggagcgcagtgtggagcgagccaagaaacgagttgtaggagat
ccttttaaccttaagacagagcagggacctcagatagatcaggagcaattcaacaagatt
ctgggatacatcagcagcgggaagagagaaggagccaagctgatgtgtggaggaggaata
gctgcagacagaggatacttcatccagcctactgtgtttggagatgtccaggacaacatg
accattgccagagaggagatttttggtccagtgatgcaaatcttgaagtttaaaacgctc
gaggaggtagtgacaagagccaatgacacaaaatatgggcttgcagccgccgtgtttact
aaggacatcgataaggccaactatgtgtccagtggacttcgtgctggcacagtctggatt
aattgctacgacgtgtttggggctcaggctccgtttggaggctacaaggcttcaggtgtc
ggcagagagctgggccagtacggcttggacaactacacagaagttaaaacggtgaccatc
aaggtactgcaaaagaattcttag

DBGET integrated database retrieval system