KEGG   Maylandia zebra (zebra mbuna): 101468193
Entry
101468193         CDS       T02814                                 

Gene name
atf6b
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04141  Protein processing in endoplasmic reticulum
mze04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101468193 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101468193 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mze03000]
    101468193 (atf6b)
Transcription factors [BR:mze03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101468193 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf HAUS6_N MCU FANCAA DUF4140
Other DBs
NCBI-GeneID: 101468193
NCBI-ProteinID: XP_024654077
LinkDB
Position
LG22
AA seq 716 aa
MGTDLLSDLDSRFFADNLLTSEDWDACLFQCESMEEGEDGDFGRGLKYDASFDNDLVLTL
DPDNPTSPWRHLDDNLLTADAPAIKNEMTITQPLPVEMLFQVKAEPPSPPSSLESECSAS
PPDPQITVKGENPPTPPYMYGDVLSPPLGSMEVTVATTAPPTQTQIAAVTQTQLQTPLTT
PIPAVIGGLQTQATVSLSPSSATLKANTILSTKPPIQPRPVCVATLPISQTATPAKALIL
QGLPSMDQTRPVVISPSVCLGSTPAIVKMEPVSPSIPQHCSSPTAPPTSKPIVPATTTLP
GNSSNGIDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRKENQAL
RERLAGKEGAESASNKRAVCVMVVLLFMTFSFGPVSITDRKLATGLHEDVVSFTGRRLLE
IEQHQQAPPPLTNKVEDKTETEEDGGDERWKRAEAKYAAEPYQFRNLSDVFSDVKDLVLQ
DIDRYFTSSDCRQFNRSESLRLGDELRGWVHRHQIDRKKSGKPKMAKKAKVAQKAQQRKT
NFSRYLPIQTHRSIESQLQVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHN
KTSRPKMSLVMPAMSVNESLYNSSQGYEMMMQVDCEVMDTRIVPIKSSAVPPSLRDPPPX
PPSSHGSSNHHHSNHTSLRGRHQHQHHPSSSSPSQRQPLPARRRTAEYLISQSEGV
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgggtacggatctgttgtcggacttggacagccgcttcttcgcggataacctgctgacg
agcgaagactgggatgcctgcctgttccagtgtgagagcatggaggagggcgaggacggg
gacttcggccgaggcttgaaatacgacgcatcgttcgacaatgacctcgtgctcaccctc
gatcctgacaaccctacgtcgccctggcgacaccttgacgacaaccttctcacagctgac
gctccggccattaaaaacgaaatgacaataacgcagccgctgccggtggagatgttgttt
caggtgaaagcagagcctccctcgcccccgtcctcgctcgagtccgagtgctcggcctct
ccacctgacccacagatcaccgttaaaggcgaaaatcctccgactcctccctacatgtac
ggagacgtgctgtcgcctcctctagggtccatggaggttaccgtagcaacaacagcaccc
ccaacacaaacccagattgctgcggtgacacagacgcagctccagacgccgctgacgacg
ccgatcccggcggtcatcggcgggctacagacgcaggctacagtctctctcagtccgagc
tcggccacgttaaaggccaacaccatcctgagcaccaaaccccccatccagccccgaccc
gtgtgcgtcgccaccctccccatctcccagaccgccacgccggccaaggcgctcatactg
cagggcctcccctccatggaccagaccagacctgtcgtcatctctccgtccgtctgcctc
ggctccacgccggccatcgtcaaaatggagcccgtctctcccagcatcccccagcactgc
tccagccccacggccccgcccaccagcaaacccatcgtcccggcgaccacgactttgccc
ggcaacagctcgaacggcatcgatatgaaagtgctgaagcggcagcagaggatgataaag
aaccgtgagtcggcctgccagtcgaggaagaagaagaaggagtacctgcagaacctggag
gctcagctgagggaggcccagcaggagaacgaacggctccgcaaggagaaccaggcactg
agggagagactggcagggaaggagggcgccgaatcagcgagtaacaagagagccgtgtgc
gtcatggtcgtcctcctcttcatgaccttcagcttcggacccgtcagcatcacagacagg
aagctggcgacgggtctgcacgaagacgtggtgtcgtttacaggacggcggctgctggag
atcgaacagcaccagcaggcgccgccgccgcttaccaacaaggtggaggacaagacggag
acggaggaggacggaggagacgagcgatggaagagagcggaggcgaaatacgccgcagag
ccgtatcagttcagaaacctgagcgacgtgttcagtgatgtgaaggacctggttctgcag
gacatcgaccgttacttcacctcctctgactgccggcagttcaaccgctccgagtctctc
aggctgggggacgagctgagaggatgggtccatcgacaccagatcgatcgcaagaagtcc
ggaaagccgaagatggccaagaaggccaaagtcgcccagaaagctcagcagaggaaaacc
aacttctccagatatctgccgatccagactcaccgctccatagaaagtcagctgcaggtg
cttcctggtcctgaggtcacctacagcgacttcctggacgccatcgaccgcagagaggac
acgttctacgtggtctcgttcagacgggatcacctcctgcttccagccatcagccacaac
aaaaccagccggcccaagatgtccctggtgatgccggccatgtctgtaaacgagagcctc
tataactcatctcaaggctacgagatgatgatgcaggtcgactgcgaggtcatggacact
cggatcgtccccatcaagtcgtccgccgttcccccctcgcttcgagacccaccccccnct
cccccctcctcccacggcagctccaaccatcaccacagcaaccacacctcactccgagga
cgccaccagcaccagcaccacccctcctcttcctctccgtctcagaggcagcctttaccc
gcccgccgacggacagctgaatacttaatcagccaatcagaaggagtctga

DBGET integrated database retrieval system