KEGG   Maylandia zebra (zebra mbuna): 101468393
Entry
101468393         CDS       T02814                                 

Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101468393
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101468393
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mze03000]
    101468393
Transcription factors [BR:mze03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101468393
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 Prominin
Other DBs
NCBI-GeneID: 101468393
NCBI-ProteinID: XP_014263575
UniProt: A0A3P9D8Q8
LinkDB
Position
LG4
AA seq 786 aa
MAVWIQAQQLQGDALHQMQSLYGQHFPIEVRHYLSQWIESQLWDAIDLENPQEEFKAKRL
LDSLIQELQNKAEHQVGEDGFLLKIKLGHYANQLKSTYDRCPLELVRCIKHILYTEQRLV
REATNSNSPVGGMMDSMSQKYQQINQAFEELRLLTQDTENDLRKLQHNQEYFIIQYQESM
RIQAQLASLATLPPADRQLREPALLSKKNTVEAWLTREANTLQKYRLDLAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGGLDILQSWCEKLAETIWQNRQQIRRAEHLR
QQLPIPGPIEELLNELNSTITDIISTLVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKALLKNENTRNDSSGEILNNNCVMEYHQTTGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFLVPDKVLWPQLCEVINMKYKAEVQSNRGLSEENLVFLAQKAFSS
SSNNPDDYRSMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPHWNDGAILGFVNK
QQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERMVWNLMPYTTKDFTIRSL
ADRISDLNHLLFLYPDRPKDEVFSKYYTPPLSKAVDGYVKPQIKQVVPEFATANPDPASG
NPTYMDQGASPAPVSHPHAYGIYPAMADSMLDADGDFDLDDTMDVARHVEELLRRPVESQ
WSGQQS
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggcggtgtggatccaggcccaacaactgcaaggagatgccctccaccagatgcaatct
ctgtacggtcagcactttccaattgaggtgcgacattatctgtcccagtggatagagagc
cagctctgggatgccatagacctggagaacccacaggaggagtttaaggccaaacgctta
ctggacagtcttatacaagagttgcagaacaaggctgagcaccaggttggggaggatggt
ttccttcttaaaatcaaactgggacactatgccaaccagctcaagagcacgtatgaccgc
tgtcctctggagctggtccgatgtatcaaacacatcctttacacagagcagaggctcgtc
cgagaggctacaaactcaaactctccagtgggtggaatgatggacagcatgtctcagaaa
taccaacagatcaaccaggcttttgaggagcttcgcctgctgacccaagacactgagaac
gatctccgcaagctccagcacaaccaggagtacttcatcatccagtaccaagaaagcatg
cgcattcaggctcaactggccagcctggccacactgccccctgctgaccgccagctacga
gagcctgcccttctgagcaagaaaaacactgtggaggcatggctgacgagagaggccaac
acactacagaaatacagactggacctggcagagaagcaccagaaaacactgcagctgttg
aggaagcagcagaccatcattctggatgacgagctgatccagtggaagagacggcaacaa
ctggcaggcaatgggggaccgccggagggaggcctggacatccttcagtcctggtgtgag
aagctcgcggaaacgatttggcaaaacaggcaacagattcggagggccgagcatctcaga
cagcagctgcctatccctggacctattgaagagctcctcaacgaactcaacagtactatc
acagatatcatttcaacactggtcaccagcacattcatcattgagaaacaacctccacag
gtccttaaaacccaaactaagtttgccgctacagtgcgccttctagtgggaggcaagctg
aacgtacacatgaatcccccacaagtcaaagctaccatcatcagtgaacagcaagccaag
gccctcttgaaaaatgaaaacacaagaaatgatagcagtggtgaaattcttaacaataac
tgtgtgatggagtaccaccagactacgggcactctgagcgcccacttcaggaacatgtct
ttaaagaggatcaagcgatcggacagacgaggagcagaatctgtcacagaagagaaattc
accattctgtttgagtcccagtttagtgttggaagcaatgagcttgtctttcaagtgaag
acattatcacttcctgtagtggtgattgttcatggtagccaagacaataatgccactgca
actgtattgtgggacaacgcttttgcagaaccgggtcgggtgcctttcctcgtgccagat
aaggtgctttggcctcagctgtgtgaggtcatcaacatgaagtacaaggcagaggtgcaa
agtaatcgaggtctgtcggaggagaacttggtatttctggctcaaaaagccttcagcagc
tccagcaacaaccctgatgactaccggagcatgactatgacctggtcacagtttaacagg
gaaagcttgccagggaggaacttcacattttggcagtggtttgatggtgtgatggaactc
acaaaaaagcatctgaaaccacactggaatgatggagccatcctgggctttgtgaacaag
cagcaagctcaggatatgctcatgtctaaacccaacggtaccttcctcctgcgctttagt
gattctgaaattggaggaattacaattgcctgggtggcagaaaatcctaacaaagcaggt
gaaagaatggtttggaaccttatgccctacacaaccaaagactttaccattcgctctctg
gctgaccgcattagtgatctcaaccaccttctattcctctaccctgacagacccaaggat
gaggttttctccaaatactacactccgcctctctctaaagcagttgacggttacgtgaaa
ccacagatcaaacaagttgtgcctgagtttgccacagccaatccagacccagcaagtggg
aatccaacttacatggatcaaggtgcctctccagcacctgtcagtcaccctcacgcctat
ggcatatatccagctatggctgactctatgttggatgcagatggagactttgacctagat
gacaccatggacgtagcgaggcatgtagaagagcttctccggcggcctgtagagagccag
tggagtggccagcagtcgtga

KEGG   Maylandia zebra (zebra mbuna): 101485426
Entry
101485426         CDS       T02814                                 

Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101485426
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101485426
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mze03000]
    101485426
Transcription factors [BR:mze03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101485426
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 PROL5-SMR Nmad5
Other DBs
NCBI-GeneID: 101485426
NCBI-ProteinID: XP_004571518
UniProt: A0A3P9B320
LinkDB
Position
LG8
AA seq 786 aa
MAMWIQAQQLQGDALHQMQALYGQHFPIEVRHYLAQWIEGQLWDSVELDNPAEETKAKRL
LDNLVAELQKKAQVQGGEDGFLLKIKLGHYASQLKSTYDRCPLELVRCIKHILQSEQRLV
QEATNASSGSGSQAMDTLSQRHQQINQAFEELRLATQETENELRKLQQSQEYFIIQYQEN
MRIQAQLSSLSSLAPTERTQRETTLQSKRATVEAWLAREASTLQKYRLDLAEQHQKTLGL
LRKQQTVILDEELIQWKRRQQLAGNGGPNEGGLDVLQSWCEKLADLIWQNRQQIRRCEHL
TQQLPLPGPMVELLSKLNADITDIISALVTSTFIIEKQPPQVLKTQTKFAATVCLLVGGK
LNVHMNPPQVKAVIVSEQQAKALLKNESTHSESSGEILNNNCVMEYHQATGTLSAHFRNM
SLKRIKRSDRRGAESVTEEKFTVLFESQFSIGGNELVFHVKTLSLPVVVIVHGSQDNNAT
ATVLWDNAFAEPGRVPFIVPEKVLWPQLCEALDMKYKAEMHSGRGLSDDNLVFLAQKAFS
SSSNNSDDYRSMTISWAQFNRESLPGRNFTFWQWFDGVVELMKKHLKPHWNDGAILGFVN
KQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKSGERLVWNLLPYTTKDFSIRS
LADRISDLNHLLYLYPDRPKDEVFAKYYTPPLSKAVDGYVKPQIKQVVPEFTTPNPEPSA
GATAFMDQTASPSVTHPNNFNVYPPMADGMLDPDGDFDLEDTMDVARHVEELLRRPMANQ
WNSQQS
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggcaatgtggatccaggcccagcagctgcagggtgatgccttgcaccagatgcaggcc
ttgtacggccagcacttccccattgaggtgcggcactacctggcccagtggattgaaggc
caactctgggactcagtggagttggataacccagcagaggaaaccaaagccaagcgtctg
ttggataatctggtggccgagctccaaaagaaagcccaggtccagggaggagaggacggc
tttctgctcaagatcaagctaggtcactatgctagccagctaaagagcacctacgaccgt
tgtcctctggaactggtccgctgcattaaacacatcctgcagtcagagcagaggctcgtt
caagaagctacaaatgccagcagtggaagtgggagccaggccatggacacgctatcacag
cgccaccagcagatcaaccaggcctttgaggagctccgactagccacacaggaaactgag
aatgaactgagaaagctgcagcagagccaggagtacttcatcatccagtaccaggagaac
atgcgcattcaagcccagctgagcagcttgtcttcactggctccaactgagcgcacccag
cgggaaacaaccctgcagagcaagcgagccactgtggaggcctggctcgccagagaggcc
agcacactacagaaatacaggcttgacctggcagaacagcaccagaagaccttgggcctg
ctgaggaaacagcagactgtgatcctggatgaggagctcattcagtggaagaggaggcaa
cagctggctggcaatgggggtcctaatgagggggggctggatgttctgcagtcctggtgt
gagaagctggctgatctgatctggcagaaccgacagcagatccgacgctgtgaacatctc
acccagcagcttcctctgccggggcccatggtagagctgctgagcaaactgaatgctgac
atcactgacatcatctctgccctggttaccagcaccttcatcatcgaaaagcagccgccc
caagtgttaaaaacccagaccaaatttgcagccacagtttgcctcctggtgggcgggaag
ctcaacgtccacatgaacccacctcaggtcaaagctgtcattgttagtgagcagcaggcc
aaggctttgctgaagaatgagagtacgcacagtgaaagcagtggagaaatcctcaataac
aactgtgtgatggagtatcaccaggccacgggcaccctcagtgcacacttcagaaacatg
tcactgaagcggatcaaacgctcggaccgtcgaggtgcagagtccgtgacagaggagaag
tttaccgttctgtttgagtcccagtttagcattgggggcaacgagctggtcttccacgtc
aaaactctgtccctgcctgtggtcgtcattgtgcacggcagccaggacaacaacgcaaca
gctacggtcctgtgggacaacgcctttgctgagccaggcagagtgccgttcattgtgcca
gagaaggtgctgtggccccagctgtgcgaggccctcgatatgaaatacaaggcagagatg
cacagtgggcgtggcctgtcagacgacaacctggtctttcttgcacagaaggctttttca
agcagcagcaacaactctgacgactaccgcagcatgaccatatcctgggcccagttcaac
agggaaagcttacctggacgcaacttcaccttctggcagtggtttgatggagtagtagag
cttatgaagaaacacctgaagcctcactggaatgatggggccattctgggctttgtaaac
aagcagcaggcacaggacatgctgatgtccaaacccaacggcactttcctgctgcggttc
agcgactctgagattggaggcatcaccatcgcctgggtggcagaaaaccccaacaaatca
ggtgagaggctggtctggaatctgctgccttacacaaccaaggacttctctattcgctcg
ctggctgaccgcatcagtgacctgaaccatctcctgtatctgtatcctgaccggcccaaa
gacgaagtcttcgccaagtactacacccccccactttcaaaagcagttgatggatatgtg
aaaccacagatcaaacaagtcgtgccagaattcaccaccccgaaccctgaacccagtgca
ggagctactgcattcatggaccagactgcttctccctctgtgacccaccccaacaacttc
aacgtctaccctcccatggctgacggcatgttggatcccgatggggactttgatctcgag
gacaccatggatgtggctcgtcatgtggaggagttgctccgcaggcctatggccaaccag
tggaacagccagcagtcctaa

DBGET integrated database retrieval system