KEGG   Maylandia zebra (zebra mbuna): 101468669
Entry
101468669         CDS       T02814                                 

Definition
(RefSeq) probetacellulin isoform X1
  KO
K09783  betacellulin
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101468669
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mze00536]
    101468669
Glycosaminoglycan binding proteins [BR:mze00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101468669
SSDB
Motif
Pfam: EphA2_TM EGF LST1 CD34_antigen PRIMA1 Stevor Sarcoglycan_2 RCR Lectin_N LYRIC TMEM154
Other DBs
NCBI-GeneID: 101468669
NCBI-ProteinID: XP_004549768
LinkDB
Position
LG7
AA seq 186 aa
MAKVHRLYVGIVIALTLCKYCLAEWNATDAPPTGTVSDCHLHGNRDNCTEDTVDTGQSNG
HFSKCPEELEYYCIHGECRYIKDQDAPSCRCQIGYIGSRCEYLNLEVQIQGKQRIIITCA
IAGLVLLILLVVFICICSRRRRRLQRDRQREEPRNGTEKLGMMMDSNATGSTLKPDSAEQ
ALTNSV
NT seq 561 nt   +upstreamnt  +downstreamnt
atggccaaagtgcacagactctatgtaggaatagtaatcgctctgaccttatgcaaatac
tgcctggcagagtggaatgccacagacgcgcctcccactggaactgtgtccgactgtcat
ctccatggcaacagagacaattgcacagaagacacagtagatactggacagtcgaatggg
cacttctcaaaatgcccagaggaacttgagtattactgcatccatggggagtgtcgttac
ataaaggaccaggatgcaccgtcctgcaggtgtcagatcggttacattggttccaggtgt
gagtacctaaatctggaggtgcagatacaaggcaaacagagaatcataattacctgtgcc
atcgcagggcttgtgctattaattcttcttgttgttttcatctgcatctgttcacgtcgt
aggaggagattgcaaagggacagacaaagggaggaaccaaggaatgggacggagaagctt
ggcatgatgatggacagcaatgcaacaggctcaactttaaagccggactcagcagagcaa
gccctcacaaattctgtatga

DBGET integrated database retrieval system